Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3669114..3669764 | Replicon | chromosome |
| Accession | NZ_CP117647 | ||
| Organism | Escherichia albertii strain BIA_16-3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PS048_RS18035 | Protein ID | WP_059224977.1 |
| Coordinates | 3669423..3669764 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A3T5VD61 |
| Locus tag | PS048_RS18030 | Protein ID | WP_025237546.1 |
| Coordinates | 3669114..3669413 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS048_RS18005 (3664471) | 3664471..3664782 | - | 312 | WP_000410252.1 | hypothetical protein | - |
| PS048_RS18010 (3664787) | 3664787..3665179 | - | 393 | WP_000273381.1 | flagellar export chaperone FliS | - |
| PS048_RS18015 (3665202) | 3665202..3666518 | - | 1317 | WP_000609691.1 | flagellar filament capping protein FliD | - |
| PS048_RS18020 (3666804) | 3666804..3667718 | - | 915 | WP_000949079.1 | lateral flagellin LafA | - |
| PS048_RS18025 (3668205) | 3668205..3669056 | + | 852 | WP_273784903.1 | winged helix-turn-helix domain-containing protein | - |
| PS048_RS18030 (3669114) | 3669114..3669413 | - | 300 | WP_025237546.1 | XRE family transcriptional regulator | Antitoxin |
| PS048_RS18035 (3669423) | 3669423..3669764 | - | 342 | WP_059224977.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS048_RS18040 (3669840) | 3669840..3670817 | - | 978 | WP_273784907.1 | flagellar hook-associated protein | - |
| PS048_RS18045 (3670834) | 3670834..3671763 | - | 930 | WP_025237548.1 | flagellar hook-associated protein FlgL | - |
| PS048_RS18050 (3671778) | 3671778..3673154 | - | 1377 | WP_131109687.1 | flagellar hook-associated protein FlgK | - |
| PS048_RS18055 (3673594) | 3673594..3673893 | - | 300 | WP_059254376.1 | rod-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13017.79 Da Isoelectric Point: 5.7334
>T271857 WP_059224977.1 NZ_CP117647:c3669764-3669423 [Escherichia albertii]
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRNHLKK
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRNHLKK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|