Detailed information of TA system TA271849

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 1918158..1918383
• Replicon: chromosome
• Accession: NZ_CP117647
• Organism: Escherichia albertii strain BIA_16-3

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: A0A8H9SPE4
• Locus tag: PS048_RS09185
• Protein ID: WP_001406737.1
• Coordinates: 1918228..1918383 (+)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	1918158..1918216 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS048_RS09150	1913229..1913903	-	675	WP_232529580.1	S24 family peptidase	-
PS048_RS09155	1913995..1914210	+	216	WP_000471549.1	Cro/CI family transcriptional regulator	-
PS048_RS09160	1914207..1914632	+	426	WP_059260010.1	toxin YdaT family protein	-
PS048_RS09165	1914704..1915774	+	1071	WP_062860011.1	hypothetical protein	-
PS048_RS09170	1915815..1916237	+	423	WP_054413023.1	DUF977 family protein	-
PS048_RS09175	1916480..1917064	+	585	WP_021559922.1	XRE family transcriptional regulator	-
PS048_RS09180	1917085..1917528	-	444	WP_054413021.1	acetyltransferase	-
-	1918158..1918216	-	59	-	-	Antitoxin
PS048_RS09185	1918228..1918383	+	156	WP_001406737.1	type I toxin-antitoxin system toxin HokD	Toxin
PS048_RS09190	1918551..1918829	+	279	WP_059225803.1	hypothetical protein	-
PS048_RS09195	1918831..1919886	+	1056	WP_059259435.1	DUF968 domain-containing protein	-
PS048_RS09200	1919887..1920252	+	366	WP_054413016.1	RusA family crossover junction endodeoxyribonuclease	-
PS048_RS09205	1920249..1920938	+	690	WP_062860010.1	bacteriophage antitermination protein Q	-
PS048_RS09230	1921622..1922185	-	564	WP_024246368.1	DUF1440 domain-containing protein	-
PS048_RS09235	1922871..1923086	+	216	WP_000839596.1	phage lysis protein EssD	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	nleC / espFu/tccP / espJ	1906242..1954899	48657

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5794.93 Da
• Isoelectric Point: 4.8535

>T271849 WP_001406737.1 NZ_CP117647:1918228-1918383 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT271849 NZ_CP117647:c1918216-1918158 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA

Structures

Antitoxin