Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1918158..1918383 | Replicon | chromosome |
| Accession | NZ_CP117647 | ||
| Organism | Escherichia albertii strain BIA_16-3 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A8H9SPE4 |
| Locus tag | PS048_RS09185 | Protein ID | WP_001406737.1 |
| Coordinates | 1918228..1918383 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1918158..1918216 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS048_RS09150 | 1913229..1913903 | - | 675 | WP_232529580.1 | S24 family peptidase | - |
| PS048_RS09155 | 1913995..1914210 | + | 216 | WP_000471549.1 | Cro/CI family transcriptional regulator | - |
| PS048_RS09160 | 1914207..1914632 | + | 426 | WP_059260010.1 | toxin YdaT family protein | - |
| PS048_RS09165 | 1914704..1915774 | + | 1071 | WP_062860011.1 | hypothetical protein | - |
| PS048_RS09170 | 1915815..1916237 | + | 423 | WP_054413023.1 | DUF977 family protein | - |
| PS048_RS09175 | 1916480..1917064 | + | 585 | WP_021559922.1 | XRE family transcriptional regulator | - |
| PS048_RS09180 | 1917085..1917528 | - | 444 | WP_054413021.1 | acetyltransferase | - |
| - | 1918158..1918216 | - | 59 | - | - | Antitoxin |
| PS048_RS09185 | 1918228..1918383 | + | 156 | WP_001406737.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| PS048_RS09190 | 1918551..1918829 | + | 279 | WP_059225803.1 | hypothetical protein | - |
| PS048_RS09195 | 1918831..1919886 | + | 1056 | WP_059259435.1 | DUF968 domain-containing protein | - |
| PS048_RS09200 | 1919887..1920252 | + | 366 | WP_054413016.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PS048_RS09205 | 1920249..1920938 | + | 690 | WP_062860010.1 | bacteriophage antitermination protein Q | - |
| PS048_RS09230 | 1921622..1922185 | - | 564 | WP_024246368.1 | DUF1440 domain-containing protein | - |
| PS048_RS09235 | 1922871..1923086 | + | 216 | WP_000839596.1 | phage lysis protein EssD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleC / espFu/tccP / espJ | 1906242..1954899 | 48657 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5794.93 Da Isoelectric Point: 4.8535
>T271849 WP_001406737.1 NZ_CP117647:1918228-1918383 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT271849 NZ_CP117647:c1918216-1918158 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|