Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1097081..1097327 | Replicon | chromosome |
| Accession | NZ_CP117647 | ||
| Organism | Escherichia albertii strain BIA_16-3 | ||
Toxin (Protein)
| Gene name | hokX | Uniprot ID | S1PD89 |
| Locus tag | PS048_RS05235 | Protein ID | WP_000956458.1 |
| Coordinates | 1097175..1097327 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokX | ||
| Locus tag | - | ||
| Coordinates | 1097081..1097133 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS048_RS05220 | 1092485..1094284 | + | 1800 | WP_273785847.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
| PS048_RS05225 | 1094284..1095996 | + | 1713 | WP_059273794.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
| PS048_RS05230 | 1096176..1096910 | + | 735 | WP_025238482.1 | phosphoadenosine phosphosulfate reductase | - |
| - | 1097081..1097133 | - | 53 | - | - | Antitoxin |
| PS048_RS05235 | 1097175..1097327 | + | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
| PS048_RS05240 | 1097453..1098490 | - | 1038 | WP_059258200.1 | alkaline phosphatase isozyme conversion aminopeptidase | - |
| PS048_RS05245 | 1098743..1099651 | + | 909 | WP_000372395.1 | sulfate adenylyltransferase subunit CysD | - |
| PS048_RS05250 | 1099653..1101080 | + | 1428 | WP_001090334.1 | sulfate adenylyltransferase subunit CysN | - |
| PS048_RS05255 | 1101080..1101685 | + | 606 | WP_059221476.1 | adenylyl-sulfate kinase | - |
| PS048_RS05260 | 1101735..1102058 | + | 324 | WP_131109461.1 | DUF3561 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T271848 WP_000956458.1 NZ_CP117647:1097175-1097327 [Escherichia albertii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 53 bp
>AT271848 NZ_CP117647:c1097133-1097081 [Escherichia albertii]
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|