Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 261788..262500 | Replicon | chromosome |
| Accession | NZ_CP117647 | ||
| Organism | Escherichia albertii strain BIA_16-3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PS048_RS01215 | Protein ID | WP_273785504.1 |
| Coordinates | 262198..262500 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS048_RS01210 | Protein ID | WP_000806446.1 |
| Coordinates | 261788..262126 (-) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS048_RS01185 (256827) | 256827..258809 | + | 1983 | WP_059236847.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
| PS048_RS01190 (258858) | 258858..259886 | + | 1029 | WP_001110408.1 | hematinate-forming heme oxygenase ChuS | - |
| PS048_RS01195 (259958) | 259958..260488 | - | 531 | WP_000480294.1 | LuxR C-terminal-related transcriptional regulator | - |
| PS048_RS01200 (260635) | 260635..261201 | - | 567 | WP_059216822.1 | outer membrane lipoprotein Slp | - |
| PS048_RS01205 (261548) | 261548..261697 | - | 150 | WP_233991781.1 | hypothetical protein | - |
| PS048_RS01210 (261788) | 261788..262126 | - | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
| PS048_RS01215 (262198) | 262198..262500 | - | 303 | WP_273785504.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS048_RS01220 (262664) | 262664..263143 | + | 480 | WP_273785506.1 | hypothetical protein | - |
| PS048_RS01225 (263233) | 263233..263406 | - | 174 | WP_044708027.1 | hypothetical protein | - |
| PS048_RS01230 (263434) | 263434..263517 | + | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
| PS048_RS01235 (263571) | 263571..264923 | - | 1353 | WP_273785509.1 | glutathione-disulfide reductase | - |
| PS048_RS01240 (264995) | 264995..265837 | - | 843 | WP_044708024.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11870.60 Da Isoelectric Point: 10.0443
>T271844 WP_273785504.1 NZ_CP117647:c262500-262198 [Escherichia albertii]
MTKKINIKDFRNAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRNAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|