Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 181936..182193 | Replicon | chromosome |
Accession | NZ_CP117647 | ||
Organism | Escherichia albertii strain BIA_16-3 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | - |
Locus tag | PS048_RS00860 | Protein ID | WP_273785483.1 |
Coordinates | 182041..182193 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 181936..181990 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS048_RS00840 | 177166..178161 | - | 996 | WP_059229190.1 | acyltransferase | - |
PS048_RS00845 | 178334..178633 | + | 300 | WP_000979961.1 | YsaB family lipoprotein | - |
PS048_RS00850 | 178729..179640 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
PS048_RS00855 | 179650..181719 | + | 2070 | WP_059221279.1 | glycine--tRNA ligase subunit beta | - |
- | 181936..181990 | - | 55 | - | - | Antitoxin |
PS048_RS00860 | 182041..182193 | + | 153 | WP_273785483.1 | type I toxin-antitoxin system toxin HokA | Toxin |
PS048_RS00865 | 182345..183031 | + | 687 | WP_273785484.1 | hypothetical protein | - |
PS048_RS00870 | 183099..183311 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
PS048_RS00875 | 183594..183884 | - | 291 | WP_000455794.1 | HTH-type transcriptional regulator | - |
PS048_RS00880 | 184307..185017 | + | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
PS048_RS00885 | 185070..186044 | - | 975 | WP_207610283.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
PS048_RS00890 | 186148..186807 | - | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5836.05 Da Isoelectric Point: 8.7820
>T271842 WP_273785483.1 NZ_CP117647:182041-182193 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSNELATFLACGNKK
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSNELATFLACGNKK
Download Length: 153 bp
Antitoxin
Download Length: 55 bp
>AT271842 NZ_CP117647:c181990-181936 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|