Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 32669..33032 | Replicon | plasmid pEA17_2 |
| Accession | NZ_CP117645 | ||
| Organism | Escherichia albertii strain BIA_17 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PS043_RS25210 | Protein ID | WP_096937776.1 |
| Coordinates | 32907..33032 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 32669..32830 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS043_RS25175 (28192) | 28192..28731 | + | 540 | WP_273817128.1 | single-stranded DNA-binding protein | - |
| PS043_RS25180 (28788) | 28788..29021 | + | 234 | WP_000006009.1 | DUF905 family protein | - |
| PS043_RS25185 (29087) | 29087..31030 | + | 1944 | WP_273817151.1 | ParB/RepB/Spo0J family partition protein | - |
| PS043_RS25190 (31099) | 31099..31533 | + | 435 | WP_273817152.1 | conjugation system SOS inhibitor PsiB | - |
| PS043_RS25195 (31530) | 31530..32175 | + | 646 | Protein_42 | plasmid SOS inhibition protein A | - |
| PS043_RS25200 (32175) | 32175..32693 | + | 519 | WP_273784129.1 | hypothetical protein | - |
| - (32763) | 32763..32828 | + | 66 | NuclAT_1 | - | - |
| - (32669) | 32669..32830 | + | 162 | NuclAT_0 | - | Antitoxin |
| - (32669) | 32669..32830 | + | 162 | NuclAT_0 | - | Antitoxin |
| - (32669) | 32669..32830 | + | 162 | NuclAT_0 | - | Antitoxin |
| - (32669) | 32669..32830 | + | 162 | NuclAT_0 | - | Antitoxin |
| - (32669) | 32669..32830 | - | 162 | NuclAT_0 | - | - |
| PS043_RS25205 (32816) | 32816..32965 | + | 150 | Protein_44 | plasmid maintenance protein Mok | - |
| PS043_RS25210 (32907) | 32907..33032 | + | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PS043_RS25215 (33326) | 33326..33976 | + | 651 | WP_273817153.1 | IS66-like element accessory protein TnpA | - |
| PS043_RS25220 (33976) | 33976..34323 | + | 348 | WP_064160280.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PS043_RS25225 (34343) | 34343..35262 | + | 920 | Protein_48 | IS66 family transposase | - |
| PS043_RS25230 (35294) | 35294..36826 | - | 1533 | WP_273817154.1 | IS3 family transposase | - |
| PS043_RS25235 (36879) | 36879..36992 | + | 114 | Protein_50 | IS3 family transposase | - |
| PS043_RS25240 (37126) | 37126..37437 | - | 312 | WP_001423339.1 | hypothetical protein | - |
| PS043_RS25245 (37453) | 37453..37683 | - | 231 | WP_000051063.1 | plasmid partition protein ParG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | bfpL / bfpK / bfpJ / bfpI / bfpH / bfpP / bfpF / bfpE / bfpD / bfpU / bfpC / bfpB / bfpG / bfpA | 1..77860 | 77860 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T271840 WP_096937776.1 NZ_CP117645:32907-33032 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 162 bp
>AT271840 NZ_CP117645:32669-32830 [Escherichia albertii]
CAGGGTGCAGACATATGGGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGT
GTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AT
CAGGGTGCAGACATATGGGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGT
GTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
