Detailed information of TA system TA271834

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 42829..43252
• Replicon: plasmid pEA17_1
• Accession: NZ_CP117644
• Organism: Escherichia albertii strain BIA_17

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PS043_RS24525
• Protein ID: WP_223200913.1
• Coordinates: 43130..43252 (+)
• Length: 41 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	42829..43045 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS043_RS24475 (38447)	38447..38616	+	170	Protein_45	hypothetical protein	-
PS043_RS24480 (38799)	38799..38879	-	81	Protein_46	hypothetical protein	-
PS043_RS24485 (38949)	38949..39209	+	261	WP_024228798.1	hypothetical protein	-
PS043_RS24490 (39302)	39302..40306	-	1005	WP_273817042.1	IS110 family transposase	-
PS043_RS24495 (40558)	40558..41097	+	540	WP_273817128.1	single-stranded DNA-binding protein	-
PS043_RS24500 (41154)	41154..41387	+	234	WP_000006009.1	DUF905 family protein	-
PS043_RS24505 (41415)	41415..41612	+	198	Protein_51	hypothetical protein	-
PS043_RS24510 (41667)	41667..42101	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
PS043_RS24515 (42098)	42098..42860	+	763	Protein_53	plasmid SOS inhibition protein A	-
- (42829)	42829..43045	+	217	NuclAT_0	-	Antitoxin
- (42829)	42829..43045	+	217	NuclAT_0	-	Antitoxin
- (42829)	42829..43045	+	217	NuclAT_0	-	Antitoxin
- (42829)	42829..43045	+	217	NuclAT_0	-	Antitoxin
PS043_RS24520 (43033)	43033..43173	+	141	Protein_54	DUF5431 family protein	-
PS043_RS24525 (43130)	43130..43252	+	123	WP_223200913.1	Hok/Gef family protein	Toxin
PS043_RS24530 (43499)	43499..44146	+	648	WP_273817129.1	IS66-like element accessory protein TnpA	-
PS043_RS24535 (44146)	44146..44493	+	348	WP_000624622.1	IS66 family insertion sequence element accessory protein TnpB	-
PS043_RS24540 (44513)	44513..46084	+	1572	WP_273817130.1	IS66 family transposase	-
PS043_RS24545 (46114)	46114..46277	+	164	Protein_59	IS3 family transposase	-
PS043_RS24550 (46365)	46365..47205	-	841	Protein_60	IS481 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	sitABCD	spvC / spvC / spvC / spvC / espK / nleA/espI / vat / iutA / iucD / iucC / iucB / iucA	1..132593	132593

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (1-35)

Sequences

Toxin

Protein

• Length: 41 a.a.
• Molecular weight: 4538.38 Da
• Isoelectric Point: 8.2691

>T271834 WP_223200913.1 NZ_CP117644:43130-43252 [Escherichia albertii]
IVCCTLLIFTLLTRNRLCEVRLKDGYREVTATMAYESGGK

Nucleotide

• Length: 123 bp

Antitoxin

Nucleotide

• Length: 217 bp

>AT271834 NZ_CP117644:42829-43045 [Escherichia albertii]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGCGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTCATTAACCCACGAGGCCTCTGCATGTCTAGTCCAC

Structures

Antitoxin