Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 42829..43252 | Replicon | plasmid pEA17_1 |
| Accession | NZ_CP117644 | ||
| Organism | Escherichia albertii strain BIA_17 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PS043_RS24525 | Protein ID | WP_223200913.1 |
| Coordinates | 43130..43252 (+) | Length | 41 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 42829..43045 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS043_RS24475 (38447) | 38447..38616 | + | 170 | Protein_45 | hypothetical protein | - |
| PS043_RS24480 (38799) | 38799..38879 | - | 81 | Protein_46 | hypothetical protein | - |
| PS043_RS24485 (38949) | 38949..39209 | + | 261 | WP_024228798.1 | hypothetical protein | - |
| PS043_RS24490 (39302) | 39302..40306 | - | 1005 | WP_273817042.1 | IS110 family transposase | - |
| PS043_RS24495 (40558) | 40558..41097 | + | 540 | WP_273817128.1 | single-stranded DNA-binding protein | - |
| PS043_RS24500 (41154) | 41154..41387 | + | 234 | WP_000006009.1 | DUF905 family protein | - |
| PS043_RS24505 (41415) | 41415..41612 | + | 198 | Protein_51 | hypothetical protein | - |
| PS043_RS24510 (41667) | 41667..42101 | + | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| PS043_RS24515 (42098) | 42098..42860 | + | 763 | Protein_53 | plasmid SOS inhibition protein A | - |
| - (42829) | 42829..43045 | + | 217 | NuclAT_0 | - | Antitoxin |
| - (42829) | 42829..43045 | + | 217 | NuclAT_0 | - | Antitoxin |
| - (42829) | 42829..43045 | + | 217 | NuclAT_0 | - | Antitoxin |
| - (42829) | 42829..43045 | + | 217 | NuclAT_0 | - | Antitoxin |
| PS043_RS24520 (43033) | 43033..43173 | + | 141 | Protein_54 | DUF5431 family protein | - |
| PS043_RS24525 (43130) | 43130..43252 | + | 123 | WP_223200913.1 | Hok/Gef family protein | Toxin |
| PS043_RS24530 (43499) | 43499..44146 | + | 648 | WP_273817129.1 | IS66-like element accessory protein TnpA | - |
| PS043_RS24535 (44146) | 44146..44493 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PS043_RS24540 (44513) | 44513..46084 | + | 1572 | WP_273817130.1 | IS66 family transposase | - |
| PS043_RS24545 (46114) | 46114..46277 | + | 164 | Protein_59 | IS3 family transposase | - |
| PS043_RS24550 (46365) | 46365..47205 | - | 841 | Protein_60 | IS481 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sitABCD | spvC / spvC / spvC / spvC / espK / nleA/espI / vat / iutA / iucD / iucC / iucB / iucA | 1..132593 | 132593 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 41 a.a. Molecular weight: 4538.38 Da Isoelectric Point: 8.2691
>T271834 WP_223200913.1 NZ_CP117644:43130-43252 [Escherichia albertii]
IVCCTLLIFTLLTRNRLCEVRLKDGYREVTATMAYESGGK
IVCCTLLIFTLLTRNRLCEVRLKDGYREVTATMAYESGGK
Download Length: 123 bp
Antitoxin
Download Length: 217 bp
>AT271834 NZ_CP117644:42829-43045 [Escherichia albertii]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGCGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTCATTAACCCACGAGGCCTCTGCATGTCTAGTCCAC
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGCGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTCATTAACCCACGAGGCCTCTGCATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|