Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-timR/SymE(toxin) |
Location | 4129920..4130332 | Replicon | chromosome |
Accession | NZ_CP117643 | ||
Organism | Escherichia albertii strain BIA_17 |
Toxin (Protein)
Gene name | symE | Uniprot ID | A0A8D9PK47 |
Locus tag | PS043_RS20815 | Protein ID | WP_000132619.1 |
Coordinates | 4129991..4130332 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | timR | ||
Locus tag | - | ||
Coordinates | 4129920..4129996 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS043_RS20805 (4126821) | 4126821..4128410 | + | 1590 | WP_157704341.1 | type I restriction-modification system methyltransferase | - |
PS043_RS20810 (4128407) | 4128407..4129762 | + | 1356 | WP_161537581.1 | restriction endonuclease subunit S | - |
- (4129920) | 4129920..4129996 | - | 77 | NuclAT_10 | - | Antitoxin |
- (4129920) | 4129920..4129996 | - | 77 | NuclAT_10 | - | Antitoxin |
- (4129920) | 4129920..4129996 | - | 77 | NuclAT_10 | - | Antitoxin |
- (4129920) | 4129920..4129996 | - | 77 | NuclAT_10 | - | Antitoxin |
- (4129920) | 4129920..4129996 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4129920) | 4129920..4129996 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4129920) | 4129920..4129996 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4129920) | 4129920..4129996 | - | 77 | NuclAT_9 | - | Antitoxin |
PS043_RS20815 (4129991) | 4129991..4130332 | + | 342 | WP_000132619.1 | endoribonuclease SymE | Toxin |
PS043_RS20820 (4130494) | 4130494..4131873 | + | 1380 | WP_059217670.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
PS043_RS20825 (4131873) | 4131873..4132919 | + | 1047 | WP_072252312.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
PS043_RS20830 (4132975) | 4132975..4134053 | - | 1079 | Protein_4080 | DUF1998 domain-containing protein | - |
PS043_RS20835 (4134370) | 4134370..4135301 | - | 932 | Protein_4081 | Rpn family recombination-promoting nuclease/putative transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12322.13 Da Isoelectric Point: 7.8219
>T271829 WP_000132619.1 NZ_CP117643:4129991-4130332 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT271829 NZ_CP117643:c4129996-4129920 [Escherichia albertii]
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|