Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4053094..4053352 | Replicon | chromosome |
| Accession | NZ_CP117643 | ||
| Organism | Escherichia albertii strain BIA_17 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | PS043_RS20445 | Protein ID | WP_000809168.1 |
| Coordinates | 4053200..4053352 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 4053094..4053151 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS043_RS20430 | 4048901..4050148 | - | 1248 | WP_059227922.1 | hypothetical protein | - |
| PS043_RS20435 | 4050302..4051795 | - | 1494 | WP_059216552.1 | sulfatase-like hydrolase/transferase | - |
| PS043_RS20440 | 4051816..4052577 | - | 762 | WP_273816559.1 | outer membrane protein OmpK | - |
| - | 4053094..4053151 | - | 58 | - | - | Antitoxin |
| PS043_RS20445 | 4053200..4053352 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| PS043_RS20450 | 4053456..4054586 | - | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
| PS043_RS20455 | 4054675..4056591 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| PS043_RS20460 | 4056966..4057370 | + | 405 | WP_000833521.1 | DUF2541 family protein | - |
| PS043_RS20465 | 4057397..4058110 | + | 714 | WP_273816560.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T271828 WP_000809168.1 NZ_CP117643:4053200-4053352 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT271828 NZ_CP117643:c4053151-4053094 [Escherichia albertii]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|