Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3778460..3779110 | Replicon | chromosome |
| Accession | NZ_CP117643 | ||
| Organism | Escherichia albertii strain BIA_17 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PS043_RS19090 | Protein ID | WP_059224977.1 |
| Coordinates | 3778460..3778801 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A3T5VD61 |
| Locus tag | PS043_RS19095 | Protein ID | WP_025237546.1 |
| Coordinates | 3778811..3779110 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS043_RS19070 (3774213) | 3774213..3774512 | + | 300 | WP_273816510.1 | rod-binding protein | - |
| PS043_RS19075 (3775070) | 3775070..3776446 | + | 1377 | WP_137653778.1 | flagellar hook-associated protein FlgK | - |
| PS043_RS19080 (3776461) | 3776461..3777390 | + | 930 | WP_001266795.1 | flagellar hook-associated protein FlgL | - |
| PS043_RS19085 (3777407) | 3777407..3778384 | + | 978 | WP_059258863.1 | hypothetical protein | - |
| PS043_RS19090 (3778460) | 3778460..3778801 | + | 342 | WP_059224977.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS043_RS19095 (3778811) | 3778811..3779110 | + | 300 | WP_025237546.1 | XRE family transcriptional regulator | Antitoxin |
| PS043_RS19100 (3779168) | 3779168..3780019 | - | 852 | WP_059258865.1 | winged helix-turn-helix domain-containing protein | - |
| PS043_RS19105 (3780506) | 3780506..3781420 | + | 915 | WP_000949079.1 | lateral flagellin LafA | - |
| PS043_RS19110 (3781729) | 3781729..3783045 | + | 1317 | WP_273816512.1 | flagellar filament capping protein FliD | - |
| PS043_RS19115 (3783068) | 3783068..3783460 | + | 393 | WP_273816513.1 | flagellar export chaperone FliS | - |
| PS043_RS19120 (3783465) | 3783465..3783776 | + | 312 | WP_000410252.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13017.79 Da Isoelectric Point: 5.7334
>T271827 WP_059224977.1 NZ_CP117643:3778460-3778801 [Escherichia albertii]
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRNHLKK
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRNHLKK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|