Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 162315..162572 | Replicon | chromosome |
| Accession | NZ_CP117643 | ||
| Organism | Escherichia albertii strain BIA_17 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | V0YDF1 |
| Locus tag | PS043_RS00745 | Protein ID | WP_001135738.1 |
| Coordinates | 162420..162572 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 162315..162369 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS043_RS00725 | 157544..158539 | - | 996 | WP_161537844.1 | acyltransferase | - |
| PS043_RS00730 | 158712..159011 | + | 300 | WP_025238111.1 | YsaB family lipoprotein | - |
| PS043_RS00735 | 159107..160018 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| PS043_RS00740 | 160028..162097 | + | 2070 | WP_273816699.1 | glycine--tRNA ligase subunit beta | - |
| - | 162315..162369 | - | 55 | - | - | Antitoxin |
| PS043_RS00745 | 162420..162572 | + | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| PS043_RS00750 | 162549..162620 | - | 72 | WP_212734940.1 | hypothetical protein | - |
| PS043_RS00755 | 162760..162972 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| PS043_RS00760 | 163255..163545 | - | 291 | WP_000455794.1 | HTH-type transcriptional regulator | - |
| PS043_RS00765 | 163968..164678 | + | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
| PS043_RS00770 | 164731..165705 | - | 975 | WP_000804993.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| PS043_RS00775 | 165809..166468 | - | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T271815 WP_001135738.1 NZ_CP117643:162420-162572 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
Antitoxin
Download Length: 55 bp
>AT271815 NZ_CP117643:c162369-162315 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|