Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 162315..162572 Replicon chromosome
Accession NZ_CP117643
Organism Escherichia albertii strain BIA_17

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag PS043_RS00745 Protein ID WP_001135738.1
Coordinates 162420..162572 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 162315..162369 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS043_RS00725 157544..158539 - 996 WP_161537844.1 acyltransferase -
PS043_RS00730 158712..159011 + 300 WP_025238111.1 YsaB family lipoprotein -
PS043_RS00735 159107..160018 + 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
PS043_RS00740 160028..162097 + 2070 WP_273816699.1 glycine--tRNA ligase subunit beta -
- 162315..162369 - 55 - - Antitoxin
PS043_RS00745 162420..162572 + 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
PS043_RS00750 162549..162620 - 72 WP_212734940.1 hypothetical protein -
PS043_RS00755 162760..162972 - 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
PS043_RS00760 163255..163545 - 291 WP_000455794.1 HTH-type transcriptional regulator -
PS043_RS00765 163968..164678 + 711 WP_002460072.1 DUF3053 domain-containing protein -
PS043_RS00770 164731..165705 - 975 WP_000804993.1 glyoxylate/hydroxypyruvate reductase GhrB -
PS043_RS00775 165809..166468 - 660 WP_000747625.1 OmpA family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T271815 WP_001135738.1 NZ_CP117643:162420-162572 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 55 bp

>AT271815 NZ_CP117643:c162369-162315 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References