Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 25735..26004 | Replicon | plasmid pEA18_3 |
| Accession | NZ_CP117640 | ||
| Organism | Escherichia albertii strain BIA_18 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PS040_RS25505 | Protein ID | WP_096937776.1 |
| Coordinates | 25879..26004 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 25735..25800 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS040_RS25470 (21197) | 21197..21616 | + | 420 | Protein_28 | single-stranded DNA-binding protein | - |
| PS040_RS25475 (21673) | 21673..21906 | + | 234 | WP_000006009.1 | DUF905 family protein | - |
| PS040_RS25480 (21972) | 21972..23928 | + | 1957 | Protein_30 | ParB/RepB/Spo0J family partition protein | - |
| PS040_RS25485 (23997) | 23997..24431 | + | 435 | WP_273784012.1 | conjugation system SOS inhibitor PsiB | - |
| PS040_RS25490 (24428) | 24428..25147 | + | 720 | WP_273784128.1 | plasmid SOS inhibition protein A | - |
| PS040_RS25495 (25147) | 25147..25665 | + | 519 | WP_273784129.1 | hypothetical protein | - |
| - (25735) | 25735..25800 | + | 66 | NuclAT_1 | - | - |
| - (25641) | 25641..25802 | + | 162 | NuclAT_0 | - | - |
| - (25641) | 25641..25802 | + | 162 | NuclAT_0 | - | - |
| - (25641) | 25641..25802 | + | 162 | NuclAT_0 | - | - |
| - (25641) | 25641..25802 | + | 162 | NuclAT_0 | - | - |
| - (25641) | 25641..25802 | - | 162 | NuclAT_0 | - | - |
| PS040_RS25500 (25788) | 25788..25937 | + | 150 | Protein_34 | plasmid maintenance protein Mok | - |
| PS040_RS25505 (25879) | 25879..26004 | + | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PS040_RS25510 (26298) | 26298..26948 | + | 651 | WP_273784130.1 | IS66-like element accessory protein TnpA | - |
| PS040_RS25515 (26948) | 26948..27286 | + | 339 | WP_273784131.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PS040_RS25520 (27338) | 27338..28396 | + | 1059 | WP_273784132.1 | IS481 family transposase | - |
| PS040_RS25525 (28416) | 28416..29985 | + | 1570 | Protein_39 | IS66 family transposase | - |
| PS040_RS25530 (30016) | 30016..30416 | - | 401 | Protein_40 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | bfpL / bfpK / bfpJ / bfpI / bfpH / bfpP / bfpF / bfpE / bfpD / bfpU / bfpC / bfpB / bfpG / bfpA | 1..71004 | 71004 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T271814 WP_096937776.1 NZ_CP117640:25879-26004 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT271814 NZ_CP117640:c25800-25735 [Escherichia albertii]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
