Detailed information of TA system TA271813

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 25641..26004
• Replicon: plasmid pEA18_3
• Accession: NZ_CP117640
• Organism: Escherichia albertii strain BIA_18

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PS040_RS25505
• Protein ID: WP_096937776.1
• Coordinates: 25879..26004 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	25641..25802 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS040_RS25470 (21197)	21197..21616	+	420	Protein_28	single-stranded DNA-binding protein	-
PS040_RS25475 (21673)	21673..21906	+	234	WP_000006009.1	DUF905 family protein	-
PS040_RS25480 (21972)	21972..23928	+	1957	Protein_30	ParB/RepB/Spo0J family partition protein	-
PS040_RS25485 (23997)	23997..24431	+	435	WP_273784012.1	conjugation system SOS inhibitor PsiB	-
PS040_RS25490 (24428)	24428..25147	+	720	WP_273784128.1	plasmid SOS inhibition protein A	-
PS040_RS25495 (25147)	25147..25665	+	519	WP_273784129.1	hypothetical protein	-
- (25735)	25735..25800	+	66	NuclAT_1	-	-
- (25641)	25641..25802	+	162	NuclAT_0	-	Antitoxin
- (25641)	25641..25802	+	162	NuclAT_0	-	Antitoxin
- (25641)	25641..25802	+	162	NuclAT_0	-	Antitoxin
- (25641)	25641..25802	+	162	NuclAT_0	-	Antitoxin
- (25641)	25641..25802	-	162	NuclAT_0	-	-
PS040_RS25500 (25788)	25788..25937	+	150	Protein_34	plasmid maintenance protein Mok	-
PS040_RS25505 (25879)	25879..26004	+	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
PS040_RS25510 (26298)	26298..26948	+	651	WP_273784130.1	IS66-like element accessory protein TnpA	-
PS040_RS25515 (26948)	26948..27286	+	339	WP_273784131.1	IS66 family insertion sequence element accessory protein TnpB	-
PS040_RS25520 (27338)	27338..28396	+	1059	WP_273784132.1	IS481 family transposase	-
PS040_RS25525 (28416)	28416..29985	+	1570	Protein_39	IS66 family transposase	-
PS040_RS25530 (30016)	30016..30416	-	401	Protein_40	transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	-	bfpL / bfpK / bfpJ / bfpI / bfpH / bfpP / bfpF / bfpE / bfpD / bfpU / bfpC / bfpB / bfpG / bfpA	1..71004	71004

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T271813 WP_096937776.1 NZ_CP117640:25879-26004 [Escherichia albertii]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 162 bp

>AT271813 NZ_CP117640:25641-25802 [Escherichia albertii]
CAGGGTGCAGACATATGGGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGT
GTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AT

Structures

Antitoxin