Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HTH(antitoxin)
Location 4676499..4677101 Replicon chromosome
Accession NZ_CP117637
Organism Escherichia albertii strain BIA_18

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PS040_RS23005 Protein ID WP_273782541.1
Coordinates 4676790..4677101 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PS040_RS23000 Protein ID WP_000356397.1
Coordinates 4676499..4676789 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS040_RS22960 (4671909) 4671909..4672811 + 903 WP_000331386.1 formate dehydrogenase O subunit beta -
PS040_RS22965 (4672808) 4672808..4673443 + 636 WP_000829019.1 formate dehydrogenase cytochrome b556 subunit -
PS040_RS22970 (4673440) 4673440..4674369 + 930 WP_000027704.1 formate dehydrogenase accessory protein FdhE -
PS040_RS22975 (4674406) 4674406..4674770 - 365 Protein_4486 type II toxin-antitoxin system VapC family toxin -
PS040_RS22980 (4674770) 4674770..4675012 - 243 WP_001275524.1 CopG family transcriptional regulator -
PS040_RS22985 (4675229) 4675229..4675447 - 219 WP_001251292.1 CopG family transcriptional regulator -
PS040_RS22990 (4675862) 4675862..4676140 - 279 WP_001296612.1 hypothetical protein -
PS040_RS22995 (4676202) 4676202..4676414 - 213 WP_000197774.1 hypothetical protein -
PS040_RS23000 (4676499) 4676499..4676789 - 291 WP_000356397.1 NadS family protein Antitoxin
PS040_RS23005 (4676790) 4676790..4677101 - 312 WP_273782541.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PS040_RS23010 (4677330) 4677330..4678238 + 909 WP_273782542.1 alpha/beta hydrolase -
PS040_RS23015 (4678302) 4678302..4679243 - 942 WP_001297068.1 fatty acid biosynthesis protein FabY -
PS040_RS23020 (4679288) 4679288..4679725 - 438 WP_000560979.1 D-aminoacyl-tRNA deacylase -
PS040_RS23025 (4679722) 4679722..4680594 - 873 WP_273782543.1 virulence factor BrkB family protein -
PS040_RS23030 (4680588) 4680588..4681187 - 600 WP_002460585.1 glucose-1-phosphatase -
PS040_RS23035 (4681286) 4681286..4682071 - 786 WP_000059671.1 DeoR/GlpR family DNA-binding transcription regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(36-85)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12150.14 Da        Isoelectric Point: 8.8941

>T271809 WP_273782541.1 NZ_CP117637:c4677101-4676790 [Escherichia albertii]
MLFIETEIFTEDVQKLLNDDEFSCFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW

Download         Length: 312 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10846.43 Da        Isoelectric Point: 10.8907

>AT271809 WP_000356397.1 NZ_CP117637:c4676789-4676499 [Escherichia albertii]
MDKALFERLTHSMAQMNEIIEGTRQPSRTFEVDAMKIKEIRRASGLSQSKFADLISVSVDTLRNWEQGRRSPTGPAKALL
RAIANDPQHVLQALNR

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References