Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-agrB/SymE(toxin) |
Location | 4155823..4156236 | Replicon | chromosome |
Accession | NZ_CP117637 | ||
Organism | Escherichia albertii strain BIA_18 |
Toxin (Protein)
Gene name | symE | Uniprot ID | A0A8D9PK47 |
Locus tag | PS040_RS20575 | Protein ID | WP_000132619.1 |
Coordinates | 4155895..4156236 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 4155823..4155900 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS040_RS20565 (4152725) | 4152725..4154314 | + | 1590 | WP_059216569.1 | type I restriction-modification system methyltransferase | - |
PS040_RS20570 (4154311) | 4154311..4155666 | + | 1356 | WP_059216570.1 | restriction endonuclease subunit S | - |
- (4155823) | 4155823..4155900 | - | 78 | NuclAT_5 | - | Antitoxin |
- (4155823) | 4155823..4155900 | - | 78 | NuclAT_5 | - | Antitoxin |
- (4155823) | 4155823..4155900 | - | 78 | NuclAT_5 | - | Antitoxin |
- (4155823) | 4155823..4155900 | - | 78 | NuclAT_5 | - | Antitoxin |
- (4155823) | 4155823..4155900 | - | 78 | NuclAT_6 | - | Antitoxin |
- (4155823) | 4155823..4155900 | - | 78 | NuclAT_6 | - | Antitoxin |
- (4155823) | 4155823..4155900 | - | 78 | NuclAT_6 | - | Antitoxin |
- (4155823) | 4155823..4155900 | - | 78 | NuclAT_6 | - | Antitoxin |
PS040_RS20575 (4155895) | 4155895..4156236 | + | 342 | WP_000132619.1 | endoribonuclease SymE | Toxin |
PS040_RS20580 (4156398) | 4156398..4157777 | + | 1380 | WP_273782439.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
PS040_RS20585 (4157777) | 4157777..4158823 | + | 1047 | WP_015953744.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
PS040_RS20590 (4158879) | 4158879..4159957 | - | 1079 | Protein_4026 | DUF1998 domain-containing protein | - |
PS040_RS20595 (4160272) | 4160272..4161204 | - | 933 | WP_273782440.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12322.13 Da Isoelectric Point: 7.8219
>T271803 WP_000132619.1 NZ_CP117637:4155895-4156236 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 78 bp
>AT271803 NZ_CP117637:c4155900-4155823 [Escherichia albertii]
AGTCATAACTGCTATTCCTTGGAAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCTTGGAAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|