Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4077772..4078030 | Replicon | chromosome |
Accession | NZ_CP117637 | ||
Organism | Escherichia albertii strain BIA_18 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | PS040_RS20200 | Protein ID | WP_000809168.1 |
Coordinates | 4077878..4078030 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4077772..4077829 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS040_RS20185 | 4073580..4074827 | - | 1248 | WP_273782426.1 | cytoplasmic protein | - |
PS040_RS20190 | 4074981..4076474 | - | 1494 | WP_273782427.1 | sulfatase-like hydrolase/transferase | - |
PS040_RS20195 | 4076495..4077256 | - | 762 | WP_105198098.1 | outer membrane protein OmpK | - |
- | 4077772..4077829 | - | 58 | - | - | Antitoxin |
PS040_RS20200 | 4077878..4078030 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
PS040_RS20205 | 4078134..4079264 | - | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
PS040_RS20210 | 4079353..4081269 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
PS040_RS20215 | 4081644..4082048 | + | 405 | WP_273782428.1 | DUF2541 family protein | - |
PS040_RS20220 | 4082075..4082788 | + | 714 | WP_001102345.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T271802 WP_000809168.1 NZ_CP117637:4077878-4078030 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT271802 NZ_CP117637:c4077829-4077772 [Escherichia albertii]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|