Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1060477..1060722 | Replicon | chromosome |
Accession | NZ_CP117637 | ||
Organism | Escherichia albertii strain BIA_18 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | S1PD89 |
Locus tag | PS040_RS05060 | Protein ID | WP_000956458.1 |
Coordinates | 1060570..1060722 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 1060477..1060525 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS040_RS05045 | 1055881..1057680 | + | 1800 | WP_273783088.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
PS040_RS05050 | 1057680..1059392 | + | 1713 | WP_001290735.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
PS040_RS05055 | 1059572..1060306 | + | 735 | WP_001125131.1 | phosphoadenosine phosphosulfate reductase | - |
- | 1060477..1060525 | - | 49 | - | - | Antitoxin |
PS040_RS05060 | 1060570..1060722 | + | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
PS040_RS05065 | 1060915..1062027 | - | 1113 | WP_273783089.1 | IS4 family transposase | - |
PS040_RS05070 | 1062280..1064937 | + | 2658 | WP_273783090.1 | CRISPR-associated helicase Cas3' | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T271794 WP_000956458.1 NZ_CP117637:1060570-1060722 [Escherichia albertii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 49 bp
>AT271794 NZ_CP117637:c1060525-1060477 [Escherichia albertii]
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|