Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 601154..601953 | Replicon | chromosome |
Accession | NZ_CP117637 | ||
Organism | Escherichia albertii strain BIA_18 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | PS040_RS02985 | Protein ID | WP_059271009.1 |
Coordinates | 601154..601618 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | PS040_RS02990 | Protein ID | WP_001296435.1 |
Coordinates | 601618..601953 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS040_RS02955 (596155) | 596155..596589 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
PS040_RS02960 (596607) | 596607..597485 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PS040_RS02965 (597475) | 597475..598254 | - | 780 | WP_000406226.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PS040_RS02970 (598265) | 598265..598738 | - | 474 | WP_059218168.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PS040_RS02975 (598761) | 598761..600041 | - | 1281 | WP_273782873.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PS040_RS02980 (600290) | 600290..601099 | + | 810 | WP_000072169.1 | aga operon transcriptional regulator AgaR | - |
PS040_RS02985 (601154) | 601154..601618 | - | 465 | WP_059271009.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PS040_RS02990 (601618) | 601618..601953 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PS040_RS02995 (602102) | 602102..603673 | - | 1572 | WP_256879795.1 | galactarate dehydratase | - |
PS040_RS03000 (604044) | 604044..605378 | + | 1335 | WP_273782877.1 | galactarate/glucarate/glycerate transporter GarP | - |
PS040_RS03005 (605394) | 605394..606164 | + | 771 | WP_025238278.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17835.26 Da Isoelectric Point: 9.6804
>T271791 WP_059271009.1 NZ_CP117637:c601618-601154 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|