Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 233677..234389 | Replicon | chromosome |
Accession | NZ_CP117637 | ||
Organism | Escherichia albertii strain BIA_18 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7U8WCQ7 |
Locus tag | PS040_RS01055 | Protein ID | WP_000162413.1 |
Coordinates | 234087..234389 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PS040_RS01050 | Protein ID | WP_000806446.1 |
Coordinates | 233677..234015 (-) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS040_RS01025 (228732) | 228732..230714 | + | 1983 | WP_107193138.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
PS040_RS01030 (230763) | 230763..231791 | + | 1029 | WP_001110409.1 | hematinate-forming heme oxygenase ChuS | - |
PS040_RS01035 (231863) | 231863..232393 | - | 531 | WP_000480294.1 | LuxR C-terminal-related transcriptional regulator | - |
PS040_RS01040 (232540) | 232540..233106 | - | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
PS040_RS01045 (233453) | 233453..233620 | - | 168 | WP_273782721.1 | hypothetical protein | - |
PS040_RS01050 (233677) | 233677..234015 | - | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
PS040_RS01055 (234087) | 234087..234389 | - | 303 | WP_000162413.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PS040_RS01060 (234553) | 234553..235032 | + | 480 | WP_273782723.1 | hypothetical protein | - |
PS040_RS01065 (235122) | 235122..235295 | - | 174 | WP_000553433.1 | hypothetical protein | - |
PS040_RS01070 (235323) | 235323..235406 | + | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
PS040_RS01075 (235460) | 235460..236812 | - | 1353 | WP_273782725.1 | glutathione-disulfide reductase | - |
PS040_RS01080 (236884) | 236884..237726 | - | 843 | WP_000954227.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11871.59 Da Isoelectric Point: 9.8664
>T271789 WP_000162413.1 NZ_CP117637:c234389-234087 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|