Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 154480..154737 Replicon chromosome
Accession NZ_CP117637
Organism Escherichia albertii strain BIA_18

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag PS040_RS00700 Protein ID WP_001135738.1
Coordinates 154585..154737 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 154480..154534 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS040_RS00680 149709..150704 - 996 WP_273782685.1 acyltransferase -
PS040_RS00685 150877..151176 + 300 WP_000979961.1 YsaB family lipoprotein -
PS040_RS00690 151272..152183 + 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
PS040_RS00695 152193..154262 + 2070 WP_273782687.1 glycine--tRNA ligase subunit beta -
- 154480..154534 - 55 - - Antitoxin
PS040_RS00700 154585..154737 + 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
PS040_RS00705 154714..154785 - 72 WP_212734940.1 hypothetical protein -
PS040_RS00710 154925..155137 - 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
PS040_RS00715 155420..155710 - 291 WP_000455794.1 HTH-type transcriptional regulator -
PS040_RS00720 156133..156843 + 711 WP_002460072.1 DUF3053 domain-containing protein -
PS040_RS00725 156896..157870 - 975 WP_000804993.1 glyoxylate/hydroxypyruvate reductase GhrB -
PS040_RS00730 157974..158633 - 660 WP_000747625.1 OmpA family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T271788 WP_001135738.1 NZ_CP117637:154585-154737 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 55 bp

>AT271788 NZ_CP117637:c154534-154480 [Escherichia albertii]
GTTCAGGTATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References