Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 41017..41281 | Replicon | plasmid pEA22_4 |
| Accession | NZ_CP117632 | ||
| Organism | Escherichia albertii strain BIA_22 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | PS041_RS26515 | Protein ID | WP_001331364.1 |
| Coordinates | 41129..41281 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 41017..41079 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS041_RS26500 (36256) | 36256..38547 | - | 2292 | WP_021520372.1 | F-type conjugative transfer protein TrbC | - |
| PS041_RS26505 (38540) | 38540..39610 | - | 1071 | WP_273825597.1 | IncI1-type conjugal transfer protein TrbB | - |
| PS041_RS26510 (39629) | 39629..40837 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (41017) | 41017..41079 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (41017) | 41017..41079 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (41017) | 41017..41079 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (41017) | 41017..41079 | - | 63 | NuclAT_0 | - | Antitoxin |
| PS041_RS26515 (41129) | 41129..41281 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| PS041_RS26520 (41353) | 41353..41604 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| PS041_RS26525 (42105) | 42105..42200 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| PS041_RS26530 (42265) | 42265..42441 | - | 177 | WP_001054904.1 | hypothetical protein | - |
| PS041_RS26535 (42837) | 42837..43046 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| PS041_RS26540 (43118) | 43118..43768 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| PS041_RS26545 (43842) | 43842..44471 | - | 630 | Protein_54 | DotA/TraY family protein | - |
| PS041_RS26550 (44563) | 44563..45791 | + | 1229 | WP_273809172.1 | IS3-like element IS2 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..51413 | 51413 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T271784 WP_001331364.1 NZ_CP117632:41129-41281 [Escherichia albertii]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT271784 NZ_CP117632:c41079-41017 [Escherichia albertii]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|