Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 41017..41281 Replicon plasmid pEA22_4
Accession NZ_CP117632
Organism Escherichia albertii strain BIA_22

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag PS041_RS26515 Protein ID WP_001331364.1
Coordinates 41129..41281 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 41017..41079 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS041_RS26500 (36256) 36256..38547 - 2292 WP_021520372.1 F-type conjugative transfer protein TrbC -
PS041_RS26505 (38540) 38540..39610 - 1071 WP_273825597.1 IncI1-type conjugal transfer protein TrbB -
PS041_RS26510 (39629) 39629..40837 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (41017) 41017..41079 - 63 NuclAT_0 - Antitoxin
- (41017) 41017..41079 - 63 NuclAT_0 - Antitoxin
- (41017) 41017..41079 - 63 NuclAT_0 - Antitoxin
- (41017) 41017..41079 - 63 NuclAT_0 - Antitoxin
PS041_RS26515 (41129) 41129..41281 + 153 WP_001331364.1 Hok/Gef family protein Toxin
PS041_RS26520 (41353) 41353..41604 - 252 WP_001291964.1 hypothetical protein -
PS041_RS26525 (42105) 42105..42200 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
PS041_RS26530 (42265) 42265..42441 - 177 WP_001054904.1 hypothetical protein -
PS041_RS26535 (42837) 42837..43046 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
PS041_RS26540 (43118) 43118..43768 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
PS041_RS26545 (43842) 43842..44471 - 630 Protein_54 DotA/TraY family protein -
PS041_RS26550 (44563) 44563..45791 + 1229 WP_273809172.1 IS3-like element IS2 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..51413 51413


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T271784 WP_001331364.1 NZ_CP117632:41129-41281 [Escherichia albertii]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT271784 NZ_CP117632:c41079-41017 [Escherichia albertii]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References