Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 83792..84046 Replicon plasmid pEA22_3
Accession NZ_CP117631
Organism Escherichia albertii strain BIA_22

Toxin (Protein)


Gene name srnB Uniprot ID A0A148HBD8
Locus tag PS041_RS26260 Protein ID WP_001336447.1
Coordinates 83897..84046 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 83792..83853 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS041_RS26230 (80146) 80146..80892 + 747 WP_273825583.1 conjugal transfer pilus acetylase TraX -
PS041_RS26235 (80947) 80947..81507 + 561 WP_273825584.1 fertility inhibition protein FinO -
PS041_RS26240 (81643) 81643..81855 + 213 WP_001299730.1 ANR family transcriptional regulator -
PS041_RS26245 (82101) 82101..82562 + 462 WP_000978818.1 thermonuclease family protein -
PS041_RS26250 (82608) 82608..82817 + 210 WP_001299729.1 hemolysin expression modulator Hha -
PS041_RS26255 (83011) 83011..83421 + 411 WP_273810621.1 hypothetical protein -
- (83792) 83792..83853 - 62 NuclAT_0 - Antitoxin
- (83792) 83792..83853 - 62 NuclAT_0 - Antitoxin
- (83792) 83792..83853 - 62 NuclAT_0 - Antitoxin
- (83792) 83792..83853 - 62 NuclAT_0 - Antitoxin
PS041_RS26260 (83897) 83897..84046 + 150 WP_001336447.1 Hok/Gef family protein Toxin
PS041_RS26265 (84330) 84330..84590 + 261 WP_021536205.1 replication regulatory protein RepA -
PS041_RS26270 (84694) 84694..84879 + 186 WP_273810622.1 plasmid copy control protein CopA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..84891 84891


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5572.69 Da        Isoelectric Point: 8.7678

>T271782 WP_001336447.1 NZ_CP117631:83897-84046 [Escherichia albertii]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT271782 NZ_CP117631:c83853-83792 [Escherichia albertii]
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A148HBD8

Antitoxin

Download structure file

References