Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 4403238..4403950 | Replicon | chromosome |
| Accession | NZ_CP117628 | ||
| Organism | Escherichia albertii strain BIA_22 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PS041_RS22055 | Protein ID | WP_149507580.1 |
| Coordinates | 4403238..4403540 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS041_RS22060 | Protein ID | WP_000806446.1 |
| Coordinates | 4403612..4403950 (+) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS041_RS22035 (4399873) | 4399873..4400715 | + | 843 | WP_001296497.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
| PS041_RS22040 (4400787) | 4400787..4402139 | + | 1353 | WP_149452210.1 | glutathione-disulfide reductase | - |
| PS041_RS22045 (4402193) | 4402193..4402276 | - | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
| PS041_RS22050 (4402567) | 4402567..4403046 | - | 480 | WP_273824558.1 | hypothetical protein | - |
| PS041_RS22055 (4403238) | 4403238..4403540 | + | 303 | WP_149507580.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS041_RS22060 (4403612) | 4403612..4403950 | + | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
| PS041_RS22065 (4404007) | 4404007..4404186 | + | 180 | WP_002460167.1 | hypothetical protein | - |
| PS041_RS22070 (4404533) | 4404533..4405099 | + | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
| PS041_RS22075 (4405246) | 4405246..4405776 | + | 531 | WP_000480294.1 | LuxR C-terminal-related transcriptional regulator | - |
| PS041_RS22080 (4405848) | 4405848..4406876 | - | 1029 | WP_001110408.1 | hematinate-forming heme oxygenase ChuS | - |
| PS041_RS22085 (4406925) | 4406925..4408906 | - | 1982 | Protein_4310 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11901.61 Da Isoelectric Point: 9.8664
>T271774 WP_149507580.1 NZ_CP117628:4403238-4403540 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPSNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPSNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|