Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2189751..2190313 | Replicon | chromosome |
| Accession | NZ_CP117628 | ||
| Organism | Escherichia albertii strain BIA_22 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7U8ZNU8 |
| Locus tag | PS041_RS10980 | Protein ID | WP_000605679.1 |
| Coordinates | 2190035..2190313 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1PAQ1 |
| Locus tag | PS041_RS10975 | Protein ID | WP_000781370.1 |
| Coordinates | 2189751..2190035 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS041_RS10960 (2184933) | 2184933..2187980 | + | 3048 | WP_273825405.1 | formate dehydrogenase-N subunit alpha | - |
| PS041_RS10965 (2187993) | 2187993..2188877 | + | 885 | WP_001240583.1 | formate dehydrogenase N subunit beta | - |
| PS041_RS10970 (2188870) | 2188870..2189523 | + | 654 | WP_000045636.1 | formate dehydrogenase-N subunit gamma | - |
| PS041_RS10975 (2189751) | 2189751..2190035 | - | 285 | WP_000781370.1 | HigA family addiction module antitoxin | Antitoxin |
| PS041_RS10980 (2190035) | 2190035..2190313 | - | 279 | WP_000605679.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS041_RS10985 (2190499) | 2190499..2191509 | - | 1011 | WP_000642385.1 | alcohol dehydrogenase AdhP | - |
| PS041_RS10990 (2191644) | 2191644..2193341 | - | 1698 | WP_059259313.1 | malate dehydrogenase | - |
| PS041_RS10995 (2193498) | 2193498..2193635 | - | 138 | WP_000841563.1 | stationary-phase-induced ribosome-associated protein | - |
| PS041_RS11000 (2193893) | 2193893..2194324 | + | 432 | WP_000152289.1 | peroxiredoxin OsmC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10533.10 Da Isoelectric Point: 7.3995
>T271766 WP_000605679.1 NZ_CP117628:c2190313-2190035 [Escherichia albertii]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAASSLVDIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAASSLVDIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U8ZNU8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2ICT | |
| PDB | 2ICP | |
| AlphaFold DB | A0A829CUG6 |