Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2054440..2054846 | Replicon | chromosome |
Accession | NZ_CP117628 | ||
Organism | Escherichia albertii strain BIA_22 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | - |
Locus tag | PS041_RS10290 | Protein ID | WP_273825356.1 |
Coordinates | 2054616..2054846 (-) | Length | 77 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2054440..2054617 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS041_RS10260 (2050217) | 2050217..2050390 | + | 174 | WP_032275239.1 | protein YnaL | - |
PS041_RS10265 (2050420) | 2050420..2051793 | + | 1374 | WP_054410409.1 | ATP-dependent RNA helicase DbpA | - |
PS041_RS10270 (2051896) | 2051896..2052831 | - | 936 | WP_001157380.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
PS041_RS10275 (2052883) | 2052883..2054118 | - | 1236 | WP_149478909.1 | site-specific integrase | - |
PS041_RS10280 (2054120) | 2054120..2054335 | - | 216 | WP_048969784.1 | excisionase XisR | - |
- (2054440) | 2054440..2054617 | + | 178 | NuclAT_0 | - | Antitoxin |
- (2054440) | 2054440..2054617 | + | 178 | NuclAT_0 | - | Antitoxin |
- (2054440) | 2054440..2054617 | + | 178 | NuclAT_0 | - | Antitoxin |
- (2054440) | 2054440..2054617 | + | 178 | NuclAT_0 | - | Antitoxin |
PS041_RS10285 (2054435) | 2054435..2054623 | - | 189 | WP_273825355.1 | DUF1187 family protein | - |
PS041_RS10290 (2054616) | 2054616..2054846 | - | 231 | WP_273825356.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
PS041_RS10295 (2054843) | 2054843..2055523 | - | 681 | WP_273825357.1 | YqaJ viral recombinase family protein | - |
PS041_RS10300 (2055520) | 2055520..2056299 | - | 780 | WP_000100866.1 | phage recombination protein Bet | - |
PS041_RS10305 (2056305) | 2056305..2056601 | - | 297 | WP_113649854.1 | host-nuclease inhibitor Gam family protein | - |
PS041_RS10310 (2056759) | 2056759..2058549 | - | 1791 | Protein_2002 | exonuclease VIII | - |
PS041_RS10315 (2058650) | 2058650..2058925 | - | 276 | WP_044805262.1 | hypothetical protein | - |
PS041_RS10320 (2059000) | 2059000..2059170 | - | 171 | WP_076735224.1 | YdaE family protein | - |
PS041_RS10325 (2059170) | 2059170..2059391 | - | 222 | WP_048969779.1 | cell division protein FtsZ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | espK / nleD / nleG7' | 2052883..2105659 | 52776 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 77 a.a. Molecular weight: 8343.51 Da Isoelectric Point: 9.2288
>T271763 WP_273825356.1 NZ_CP117628:c2054846-2054616 [Escherichia albertii]
MSATTKLTGEKPERYTKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTAENINGGIYV
MSATTKLTGEKPERYTKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTAENINGGIYV
Download Length: 231 bp
Antitoxin
Download Length: 178 bp
>AT271763 NZ_CP117628:2054440-2054617 [Escherichia albertii]
AGGACTGAAGTTTCTCGCAATTAAAATTCATCAGTTTTACTTTTTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGAG
AGCATTTTTTCGCATTCTGATTTCGTTAGTTTATATTTTGAATATCTTGTCCAGTTAGTAGGAGTACCACCTTCCTTTTC
AATTGTGGCGGTAATTTT
AGGACTGAAGTTTCTCGCAATTAAAATTCATCAGTTTTACTTTTTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGAG
AGCATTTTTTCGCATTCTGATTTCGTTAGTTTATATTTTGAATATCTTGTCCAGTTAGTAGGAGTACCACCTTCCTTTTC
AATTGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|