Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 1772937..1773162 Replicon chromosome
Accession NZ_CP117628
Organism Escherichia albertii strain BIA_22

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag PS041_RS08720 Protein ID WP_000813254.1
Coordinates 1773007..1773162 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 1772937..1772995 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS041_RS08690 1767938..1768363 + 426 WP_059217916.1 toxin YdaT family protein -
PS041_RS08695 1768387..1769319 + 933 WP_273825262.1 helix-turn-helix domain-containing protein -
PS041_RS08700 1769326..1770071 + 746 Protein_1688 ATP-binding protein -
PS041_RS08705 1770094..1770855 + 762 WP_059217918.1 DUF1627 domain-containing protein -
PS041_RS08710 1770863..1771273 + 411 WP_059217919.1 DUF977 family protein -
PS041_RS08715 1771629..1772402 - 774 WP_059217920.1 alpha/beta hydrolase -
- 1772937..1772995 - 59 - - Antitoxin
PS041_RS08720 1773007..1773162 + 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
PS041_RS08725 1773330..1773608 + 279 WP_032084570.1 hypothetical protein -
PS041_RS08730 1773610..1774659 + 1050 WP_273825264.1 DUF968 domain-containing protein -
PS041_RS08735 1774672..1775039 + 368 Protein_1695 RusA family crossover junction endodeoxyribonuclease -
PS041_RS08740 1775032..1775400 + 369 WP_059217965.1 antiterminator Q family protein -
PS041_RS08745 1775543..1776361 + 819 WP_072252351.1 CPBP family intramembrane metalloprotease -
PS041_RS08760 1777161..1777238 + 78 Protein_1698 phage holin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - espM2 1756509..1825024 68515


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T271762 WP_000813254.1 NZ_CP117628:1773007-1773162 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT271762 NZ_CP117628:c1772995-1772937 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References