Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 4383804..4384516 | Replicon | chromosome |
Accession | NZ_CP117620 | ||
Organism | Escherichia albertii strain BIA_24 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A8D9ULK1 |
Locus tag | PS039_RS21355 | Protein ID | WP_059257620.1 |
Coordinates | 4383804..4384106 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PS039_RS21360 | Protein ID | WP_000806446.1 |
Coordinates | 4384178..4384516 (+) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS039_RS21330 (4380467) | 4380467..4381309 | + | 843 | WP_000954227.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
PS039_RS21335 (4381381) | 4381381..4382733 | + | 1353 | WP_059225142.1 | glutathione-disulfide reductase | - |
PS039_RS21340 (4382787) | 4382787..4382870 | - | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
PS039_RS21345 (4382898) | 4382898..4383071 | + | 174 | WP_059225143.1 | hypothetical protein | - |
PS039_RS21350 (4383161) | 4383161..4383640 | - | 480 | WP_273809833.1 | hypothetical protein | - |
PS039_RS21355 (4383804) | 4383804..4384106 | + | 303 | WP_059257620.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PS039_RS21360 (4384178) | 4384178..4384516 | + | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
PS039_RS21365 (4384573) | 4384573..4384752 | + | 180 | WP_002460167.1 | hypothetical protein | - |
PS039_RS21370 (4385088) | 4385088..4385654 | + | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
PS039_RS21375 (4385801) | 4385801..4386331 | + | 531 | WP_000480294.1 | LuxR C-terminal-related transcriptional regulator | - |
PS039_RS21380 (4386403) | 4386403..4387431 | - | 1029 | WP_001110408.1 | hematinate-forming heme oxygenase ChuS | - |
PS039_RS21385 (4387480) | 4387480..4389462 | - | 1983 | WP_000089601.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11843.53 Da Isoelectric Point: 9.8664
>T271748 WP_059257620.1 NZ_CP117620:4383804-4384106 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWANGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWANGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|