Detailed information of TA system TA271736

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 2077591..2077816
• Replicon: chromosome
• Accession: NZ_CP117620
• Organism: Escherichia albertii strain BIA_24

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: S1ELB5
• Locus tag: PS039_RS10005
• Protein ID: WP_000813254.1
• Coordinates: 2077661..2077816 (+)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	2077591..2077649 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS039_RS09965	2072694..2073482	+	789	WP_059279425.1	hypothetical protein	-
PS039_RS09970	2073489..2074235	+	747	WP_048969775.1	ATP-binding protein	-
PS039_RS09975	2074258..2075019	+	762	WP_273810514.1	DUF1627 domain-containing protein	-
PS039_RS09980	2075027..2075443	+	417	WP_273810515.1	DUF977 family protein	-
PS039_RS09985	2075440..2075704	+	265	Protein_1935	hypothetical protein	-
PS039_RS09990	2075700..2076002	+	303	WP_273810571.1	hypothetical protein	-
PS039_RS09995	2076133..2076561	+	429	WP_233991577.1	hypothetical protein	-
PS039_RS10000	2076563..2077114	+	552	WP_233991578.1	DUF551 domain-containing protein	-
-	2077591..2077649	-	59	-	-	Antitoxin
PS039_RS10005	2077661..2077816	+	156	WP_000813254.1	type I toxin-antitoxin system toxin HokD	Toxin
PS039_RS10010	2078092..2078304	+	213	WP_072248386.1	hypothetical protein	-
PS039_RS10015	2078376..2078975	+	600	WP_059214836.1	DUF1367 family protein	-
PS039_RS10020	2078975..2079264	+	290	Protein_1942	DUF1364 domain-containing protein	-
PS039_RS10025	2079261..2079803	+	543	WP_059214837.1	DUF1133 family protein	-
PS039_RS10030	2080301..2080636	+	336	WP_001766841.1	phage holin, lambda family	-
PS039_RS10035	2080640..2081116	+	477	WP_047655280.1	glycoside hydrolase family protein	-
PS039_RS10040	2081100..2081480	+	381	WP_059268182.1	DUF2570 domain-containing protein	-
PS039_RS10045	2081365..2081643	+	279	WP_224543230.1	hypothetical protein	-
PS039_RS10050	2081927..2082184	+	258	Protein_1948	ParB/Srx family N-terminal domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	2062869..2106274	43405

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5736.89 Da
• Isoelectric Point: 6.1531

>T271736 WP_000813254.1 NZ_CP117620:2077661-2077816 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT271736 NZ_CP117620:c2077649-2077591 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA

Structures

Toxin

• AlphaFold DB: A0A4P7TMW0

Antitoxin