Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2077591..2077816 | Replicon | chromosome |
| Accession | NZ_CP117620 | ||
| Organism | Escherichia albertii strain BIA_24 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | PS039_RS10005 | Protein ID | WP_000813254.1 |
| Coordinates | 2077661..2077816 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2077591..2077649 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS039_RS09965 | 2072694..2073482 | + | 789 | WP_059279425.1 | hypothetical protein | - |
| PS039_RS09970 | 2073489..2074235 | + | 747 | WP_048969775.1 | ATP-binding protein | - |
| PS039_RS09975 | 2074258..2075019 | + | 762 | WP_273810514.1 | DUF1627 domain-containing protein | - |
| PS039_RS09980 | 2075027..2075443 | + | 417 | WP_273810515.1 | DUF977 family protein | - |
| PS039_RS09985 | 2075440..2075704 | + | 265 | Protein_1935 | hypothetical protein | - |
| PS039_RS09990 | 2075700..2076002 | + | 303 | WP_273810571.1 | hypothetical protein | - |
| PS039_RS09995 | 2076133..2076561 | + | 429 | WP_233991577.1 | hypothetical protein | - |
| PS039_RS10000 | 2076563..2077114 | + | 552 | WP_233991578.1 | DUF551 domain-containing protein | - |
| - | 2077591..2077649 | - | 59 | - | - | Antitoxin |
| PS039_RS10005 | 2077661..2077816 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| PS039_RS10010 | 2078092..2078304 | + | 213 | WP_072248386.1 | hypothetical protein | - |
| PS039_RS10015 | 2078376..2078975 | + | 600 | WP_059214836.1 | DUF1367 family protein | - |
| PS039_RS10020 | 2078975..2079264 | + | 290 | Protein_1942 | DUF1364 domain-containing protein | - |
| PS039_RS10025 | 2079261..2079803 | + | 543 | WP_059214837.1 | DUF1133 family protein | - |
| PS039_RS10030 | 2080301..2080636 | + | 336 | WP_001766841.1 | phage holin, lambda family | - |
| PS039_RS10035 | 2080640..2081116 | + | 477 | WP_047655280.1 | glycoside hydrolase family protein | - |
| PS039_RS10040 | 2081100..2081480 | + | 381 | WP_059268182.1 | DUF2570 domain-containing protein | - |
| PS039_RS10045 | 2081365..2081643 | + | 279 | WP_224543230.1 | hypothetical protein | - |
| PS039_RS10050 | 2081927..2082184 | + | 258 | Protein_1948 | ParB/Srx family N-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2062869..2106274 | 43405 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T271736 WP_000813254.1 NZ_CP117620:2077661-2077816 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT271736 NZ_CP117620:c2077649-2077591 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|