Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2064425..2064795 | Replicon | chromosome |
Accession | NZ_CP117620 | ||
Organism | Escherichia albertii strain BIA_24 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | - |
Locus tag | PS039_RS09905 | Protein ID | WP_059278633.1 |
Coordinates | 2064601..2064795 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2064425..2064602 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS039_RS09875 (2060203) | 2060203..2060376 | + | 174 | WP_032275239.1 | protein YnaL | - |
PS039_RS09880 (2060406) | 2060406..2061779 | + | 1374 | WP_000123704.1 | ATP-dependent RNA helicase DbpA | - |
PS039_RS09885 (2061882) | 2061882..2062817 | - | 936 | WP_044712357.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
PS039_RS09890 (2062869) | 2062869..2064104 | - | 1236 | WP_072249326.1 | site-specific integrase | - |
PS039_RS09895 (2064106) | 2064106..2064321 | - | 216 | WP_048969784.1 | excisionase XisR | - |
- (2064425) | 2064425..2064602 | + | 178 | NuclAT_0 | - | Antitoxin |
- (2064425) | 2064425..2064602 | + | 178 | NuclAT_0 | - | Antitoxin |
- (2064425) | 2064425..2064602 | + | 178 | NuclAT_0 | - | Antitoxin |
- (2064425) | 2064425..2064602 | + | 178 | NuclAT_0 | - | Antitoxin |
PS039_RS09900 (2064420) | 2064420..2064608 | - | 189 | WP_059278634.1 | DUF1187 family protein | - |
PS039_RS09905 (2064601) | 2064601..2064795 | - | 195 | WP_059278633.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
PS039_RS09910 (2064860) | 2064860..2065954 | - | 1095 | WP_273810513.1 | RecT family recombinase | - |
PS039_RS09915 (2065969) | 2065969..2069094 | - | 3126 | WP_059278632.1 | exodeoxyribonuclease VIII | - |
PS039_RS09920 (2069194) | 2069194..2069469 | - | 276 | WP_059278631.1 | hypothetical protein | - |
PS039_RS09925 (2069544) | 2069544..2069714 | - | 171 | WP_076741965.1 | YdaE family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2062869..2106274 | 43405 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7068.10 Da Isoelectric Point: 8.7468
>T271733 WP_059278633.1 NZ_CP117620:c2064795-2064601 [Escherichia albertii]
MRYEKVKPCPFCGCPSVTVKAISGCYRAKCNGCESRTGYGGSEKEALERWNKRTAENINGGIYV
MRYEKVKPCPFCGCPSVTVKAISGCYRAKCNGCESRTGYGGSEKEALERWNKRTAENINGGIYV
Download Length: 195 bp
Antitoxin
Download Length: 178 bp
>AT271733 NZ_CP117620:2064425-2064602 [Escherichia albertii]
AGGACTGAAGTTTCTCGCAATTAAAATTCATCAGTTTTACATTTTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGAG
AGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTACCTCCTTCCTTTTC
AATTGTGGCGGTAATTTT
AGGACTGAAGTTTCTCGCAATTAAAATTCATCAGTTTTACATTTTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGAG
AGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTACCTCCTTCCTTTTC
AATTGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|