Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 94964..95218 Replicon plasmid pEA25_2
Accession NZ_CP117617
Organism Escherichia albertii strain BIA_25

Toxin (Protein)


Gene name srnB Uniprot ID A0A148HBD8
Locus tag PS046_RS24390 Protein ID WP_001336447.1
Coordinates 95069..95218 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 94964..95025 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS046_RS24360 (91324) 91324..92064 + 741 WP_273813380.1 conjugal transfer pilus acetylase TraX -
PS046_RS24365 (92119) 92119..92679 + 561 WP_273813382.1 fertility inhibition protein FinO -
PS046_RS24370 (92815) 92815..93027 + 213 WP_001299730.1 ANR family transcriptional regulator -
PS046_RS24375 (93273) 93273..93734 + 462 WP_000978818.1 thermonuclease family protein -
PS046_RS24380 (93780) 93780..93989 + 210 WP_001299729.1 hemolysin expression modulator Hha -
PS046_RS24385 (94183) 94183..94593 + 411 WP_273810621.1 hypothetical protein -
- (94964) 94964..95025 - 62 NuclAT_0 - Antitoxin
- (94964) 94964..95025 - 62 NuclAT_0 - Antitoxin
- (94964) 94964..95025 - 62 NuclAT_0 - Antitoxin
- (94964) 94964..95025 - 62 NuclAT_0 - Antitoxin
PS046_RS24390 (95069) 95069..95218 + 150 WP_001336447.1 Hok/Gef family protein Toxin
PS046_RS24395 (95502) 95502..95762 + 261 WP_021536205.1 replication regulatory protein RepA -
PS046_RS24400 (95866) 95866..96051 + 186 WP_273810622.1 plasmid copy control protein CopA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..96063 96063


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5572.69 Da        Isoelectric Point: 8.7678

>T271722 WP_001336447.1 NZ_CP117617:95069-95218 [Escherichia albertii]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT271722 NZ_CP117617:c95025-94964 [Escherichia albertii]
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A148HBD8

Antitoxin

Download structure file

References