Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3993235..3993493 | Replicon | chromosome |
| Accession | NZ_CP117615 | ||
| Organism | Escherichia albertii strain BIA_25 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | PS046_RS19415 | Protein ID | WP_000809168.1 |
| Coordinates | 3993341..3993493 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 3993235..3993292 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS046_RS19400 | 3989043..3990290 | - | 1248 | WP_095573584.1 | cytoplasmic protein | - |
| PS046_RS19405 | 3990444..3991937 | - | 1494 | WP_095573583.1 | sulfatase-like hydrolase/transferase | - |
| PS046_RS19410 | 3991958..3992719 | - | 762 | WP_095573582.1 | outer membrane protein OmpK | - |
| - | 3993235..3993292 | - | 58 | - | - | Antitoxin |
| PS046_RS19415 | 3993341..3993493 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| PS046_RS19420 | 3993571..3994683 | + | 1113 | WP_095573581.1 | IS4-like element IS421 family transposase | - |
| PS046_RS19425 | 3994946..3996076 | - | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
| PS046_RS19430 | 3996165..3998081 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T271718 WP_000809168.1 NZ_CP117615:3993341-3993493 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT271718 NZ_CP117615:c3993292-3993235 [Escherichia albertii]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|