Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3716346..3717040 | Replicon | chromosome |
Accession | NZ_CP117615 | ||
Organism | Escherichia albertii strain BIA_25 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | PS046_RS18140 | Protein ID | WP_001263500.1 |
Coordinates | 3716346..3716744 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | PS046_RS18145 | Protein ID | WP_000554758.1 |
Coordinates | 3716747..3717040 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS046_RS18110 (3711480) | 3711480..3712937 | + | 1458 | WP_001292996.1 | cytosol nonspecific dipeptidase | - |
PS046_RS18115 (3712985) | 3712985..3713227 | + | 243 | WP_001029361.1 | hypothetical protein | - |
PS046_RS18120 (3713244) | 3713244..3713753 | - | 510 | WP_001361775.1 | metal-dependent hydrolase | - |
PS046_RS18125 (3713815) | 3713815..3714429 | - | 615 | WP_095573646.1 | peptide chain release factor H | - |
PS046_RS18130 (3714426) | 3714426..3715565 | - | 1140 | WP_233929378.1 | RNA ligase RtcB family protein | - |
PS046_RS18135 (3715884) | 3715884..3716336 | - | 453 | WP_273812271.1 | GNAT family N-acetyltransferase | - |
PS046_RS18140 (3716346) | 3716346..3716744 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
PS046_RS18145 (3716747) | 3716747..3717040 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
PS046_RS18150 (3717092) | 3717092..3718147 | - | 1056 | WP_059217800.1 | DNA polymerase IV | - |
PS046_RS18155 (3718277) | 3718277..3719044 | - | 768 | WP_072243690.1 | putative lateral flagellar export/assembly protein LafU | - |
PS046_RS18160 (3719016) | 3719016..3720728 | + | 1713 | Protein_3553 | flagellar biosynthesis protein FlhA | - |
PS046_RS18165 (3720844) | 3720844..3721341 | - | 498 | WP_095573642.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T271717 WP_001263500.1 NZ_CP117615:c3716744-3716346 [Escherichia albertii]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|