Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2829881..2830106 Replicon chromosome
Accession NZ_CP117615
Organism Escherichia albertii strain BIA_25

Toxin (Protein)


Gene name hokW Uniprot ID A0A7L6L988
Locus tag PS046_RS13960 Protein ID WP_000813269.1
Coordinates 2829881..2830036 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2830048..2830106 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS046_RS13900 2825083..2825160 - 78 Protein_2727 phage holin -
PS046_RS13925 2826058..2826939 + 882 WP_021526742.1 hypothetical protein -
PS046_RS13930 2826955..2827218 + 264 WP_021526743.1 hypothetical protein -
PS046_RS13935 2827208..2827606 + 399 WP_024190350.1 hypothetical protein -
PS046_RS13940 2827642..2828010 - 369 WP_021526745.1 antiterminator Q family protein -
PS046_RS13945 2828000..2828377 - 378 Protein_2732 RusA family crossover junction endodeoxyribonuclease -
PS046_RS13950 2828378..2829433 - 1056 WP_273810463.1 DUF968 domain-containing protein -
PS046_RS13955 2829435..2829713 - 279 WP_137651311.1 hypothetical protein -
PS046_RS13960 2829881..2830036 - 156 WP_000813269.1 type I toxin-antitoxin system toxin HokD Toxin
- 2830048..2830106 + 59 - - Antitoxin
PS046_RS13965 2830641..2831414 + 774 WP_059217920.1 alpha/beta hydrolase -
PS046_RS13970 2831770..2832180 - 411 WP_137651310.1 DUF977 family protein -
PS046_RS13975 2832188..2832949 - 762 WP_059217918.1 DUF1627 domain-containing protein -
PS046_RS13980 2832972..2833718 - 747 WP_273810462.1 ATP-binding protein -
PS046_RS13985 2833725..2834687 - 963 WP_137651308.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2819361..2849469 30108


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5722.86 Da        Isoelectric Point: 6.1531

>T271714 WP_000813269.1 NZ_CP117615:c2830036-2829881 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT271714 NZ_CP117615:2830048-2830106 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7L6L988

Antitoxin

Download structure file

References