Detailed information of TA system TA271712

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 2578796..2579021
• Replicon: chromosome
• Accession: NZ_CP117615
• Organism: Escherichia albertii strain BIA_25

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: A0A7L6L988
• Locus tag: PS046_RS12605
• Protein ID: WP_000813269.1
• Coordinates: 2578796..2578951 (-)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	2578963..2579021 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS046_RS12560	2574501..2574758	-	258	Protein_2461	ParB/Srx family N-terminal domain-containing protein	-
PS046_RS12565	2575042..2575320	-	279	WP_224543230.1	hypothetical protein	-
PS046_RS12570	2575205..2575585	-	381	WP_059268182.1	DUF2570 domain-containing protein	-
PS046_RS12575	2575569..2576045	-	477	WP_047655280.1	glycoside hydrolase family protein	-
PS046_RS12580	2576049..2576384	-	336	WP_001766841.1	phage holin, lambda family	-
PS046_RS12585	2576882..2577424	-	543	WP_262928907.1	DUF1133 family protein	-
PS046_RS12590	2577421..2577711	-	291	WP_000228020.1	DUF1364 domain-containing protein	-
PS046_RS12595	2577711..2578310	-	600	WP_273811879.1	DUF1367 family protein	-
PS046_RS12600	2578466..2578543	-	78	Protein_2469	hypothetical protein	-
PS046_RS12605	2578796..2578951	-	156	WP_000813269.1	type I toxin-antitoxin system toxin HokD	Toxin
-	2578963..2579021	+	59	-	-	Antitoxin
PS046_RS12610	2579379..2580311	+	933	WP_059259885.1	hypothetical protein	-
PS046_RS12615	2580308..2580862	+	555	WP_024229929.1	hypothetical protein	-
PS046_RS12620	2580996..2581307	-	312	WP_032320575.1	hypothetical protein	-
PS046_RS12625	2581294..2581557	-	264	WP_024229931.1	hypothetical protein	-
PS046_RS12630	2581554..2581970	-	417	WP_024229932.1	DUF977 family protein	-
PS046_RS12635	2581978..2582739	-	762	WP_074464991.1	DUF1627 domain-containing protein	-
PS046_RS12640	2582762..2583508	-	747	WP_273811888.1	ATP-binding protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	nleG7' / nleD / nleH1	2536982..2596860	59878

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5722.86 Da
• Isoelectric Point: 6.1531

>T271712 WP_000813269.1 NZ_CP117615:c2578951-2578796 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT271712 NZ_CP117615:2578963-2579021 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Structures

Toxin

• AlphaFold DB: A0A7L6L988

Antitoxin