Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1120277..1120521 | Replicon | chromosome |
Accession | NZ_CP117615 | ||
Organism | Escherichia albertii strain BIA_25 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | S1PD89 |
Locus tag | PS046_RS05380 | Protein ID | WP_000956458.1 |
Coordinates | 1120369..1120521 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 1120277..1120324 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS046_RS05365 | 1115680..1117479 | + | 1800 | WP_095574182.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
PS046_RS05370 | 1117479..1119191 | + | 1713 | WP_059221001.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
PS046_RS05375 | 1119371..1120105 | + | 735 | WP_001125132.1 | phosphoadenosine phosphosulfate reductase | - |
- | 1120277..1120324 | - | 48 | - | - | Antitoxin |
PS046_RS05380 | 1120369..1120521 | + | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
PS046_RS05385 | 1120714..1121826 | - | 1113 | WP_095574181.1 | IS4-like element IS421 family transposase | - |
PS046_RS05390 | 1122079..1124736 | + | 2658 | WP_059221338.1 | CRISPR-associated helicase/endonuclease Cas3 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T271705 WP_000956458.1 NZ_CP117615:1120369-1120521 [Escherichia albertii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 48 bp
>AT271705 NZ_CP117615:c1120324-1120277 [Escherichia albertii]
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTG
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|