Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 250100..250812 | Replicon | chromosome |
| Accession | NZ_CP117615 | ||
| Organism | Escherichia albertii strain BIA_25 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7U8WCQ7 |
| Locus tag | PS046_RS01150 | Protein ID | WP_000162413.1 |
| Coordinates | 250510..250812 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS046_RS01145 | Protein ID | WP_000806446.1 |
| Coordinates | 250100..250438 (-) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS046_RS01120 (245732) | 245732..246760 | + | 1029 | WP_001110409.1 | hematinate-forming heme oxygenase ChuS | - |
| PS046_RS01125 (246832) | 246832..247362 | - | 531 | WP_059220985.1 | LuxR C-terminal-related transcriptional regulator | - |
| PS046_RS01130 (247509) | 247509..248075 | - | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
| PS046_RS01135 (248281) | 248281..249417 | - | 1137 | WP_095574327.1 | pentapeptide repeat-containing protein | - |
| PS046_RS01140 (249864) | 249864..250043 | - | 180 | WP_002460167.1 | hypothetical protein | - |
| PS046_RS01145 (250100) | 250100..250438 | - | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
| PS046_RS01150 (250510) | 250510..250812 | - | 303 | WP_000162413.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS046_RS01155 (250976) | 250976..251470 | + | 495 | WP_095574326.1 | hypothetical protein | - |
| PS046_RS01160 (251544) | 251544..251717 | - | 174 | WP_059235695.1 | hypothetical protein | - |
| PS046_RS01165 (251745) | 251745..251828 | + | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
| PS046_RS01170 (251882) | 251882..253234 | - | 1353 | WP_054410173.1 | glutathione-disulfide reductase | - |
| PS046_RS01175 (253306) | 253306..254148 | - | 843 | WP_000954227.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11871.59 Da Isoelectric Point: 9.8664
>T271701 WP_000162413.1 NZ_CP117615:c250812-250510 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|