Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 173177..173434 | Replicon | chromosome |
| Accession | NZ_CP117615 | ||
| Organism | Escherichia albertii strain BIA_25 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | V0YDF1 |
| Locus tag | PS046_RS00805 | Protein ID | WP_001135738.1 |
| Coordinates | 173282..173434 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 173177..173225 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS046_RS00785 | 168407..169402 | - | 996 | Protein_155 | acyltransferase | - |
| PS046_RS00790 | 169575..169874 | + | 300 | WP_000979961.1 | YsaB family lipoprotein | - |
| PS046_RS00795 | 169970..170881 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| PS046_RS00800 | 170891..172960 | + | 2070 | WP_095574339.1 | glycine--tRNA ligase subunit beta | - |
| - | 173177..173225 | - | 49 | - | - | Antitoxin |
| PS046_RS00805 | 173282..173434 | + | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| PS046_RS00810 | 173411..173482 | - | 72 | WP_212734940.1 | hypothetical protein | - |
| PS046_RS00815 | 173622..173834 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| PS046_RS00820 | 174117..174407 | - | 291 | WP_059221281.1 | HTH-type transcriptional regulator | - |
| PS046_RS00825 | 174830..175540 | + | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
| PS046_RS00830 | 175593..176567 | - | 975 | WP_059221283.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| PS046_RS00835 | 176671..177330 | - | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T271700 WP_001135738.1 NZ_CP117615:173282-173434 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
Antitoxin
Download Length: 49 bp
>AT271700 NZ_CP117615:c173225-173177 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|