Detailed information of TA system TA271696

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 98141..98564
• Replicon: plasmid pEA26_2
• Accession: NZ_CP117611
• Organism: Escherichia albertii strain BIA_26

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PS038_RS23470
• Protein ID: WP_223200913.1
• Coordinates: 98141..98263 (-)
• Length: 41 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	98348..98564 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS038_RS23440 (93711)	93711..93986	+	276	WP_273817993.1	secretion protein EspO	-
PS038_RS23445 (94188)	94188..95028	+	841	Protein_104	IS481 family transposase	-
PS038_RS23450 (95116)	95116..95279	-	164	Protein_105	IS3 family transposase	-
PS038_RS23455 (95309)	95309..96880	-	1572	WP_273818331.1	IS66 family transposase	-
PS038_RS23460 (96900)	96900..97247	-	348	WP_000624622.1	IS66 family insertion sequence element accessory protein TnpB	-
PS038_RS23465 (97247)	97247..97894	-	648	WP_273817995.1	IS66-like element accessory protein TnpA	-
PS038_RS23470 (98141)	98141..98263	-	123	WP_223200913.1	Hok/Gef family protein	Toxin
PS038_RS23475 (98208)	98208..98360	-	153	Protein_110	DUF5431 family protein	-
- (98348)	98348..98564	-	217	NuclAT_0	-	Antitoxin
- (98348)	98348..98564	-	217	NuclAT_0	-	Antitoxin
- (98348)	98348..98564	-	217	NuclAT_0	-	Antitoxin
- (98348)	98348..98564	-	217	NuclAT_0	-	Antitoxin
PS038_RS23480 (98509)	98509..99295	-	787	Protein_111	plasmid SOS inhibition protein A	-
PS038_RS23485 (99292)	99292..99642	-	351	Protein_112	conjugation system SOS inhibitor PsiB	-
PS038_RS23490 (99722)	99722..99913	-	192	WP_001027495.1	hypothetical protein	-
PS038_RS23495 (99858)	99858..100331	-	474	WP_273818332.1	hypothetical protein	-
PS038_RS23500 (100378)	100378..100803	-	426	WP_273818333.1	antirestriction protein	-
PS038_RS23505 (100974)	100974..101693	-	720	WP_273818367.1	hypothetical protein	-
PS038_RS23510 (101854)	101854..103023	+	1170	Protein_117	RNA-guided endonuclease TnpB family protein	-
PS038_RS23515 (103063)	103063..103236	+	174	Protein_118	DUF4113 domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	vat / espK	1..107716	107716
	-	inside	IScluster/Tn	-	espK	78831..107070	28239

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (1-35)

Sequences

Toxin

Protein

• Length: 41 a.a.
• Molecular weight: 4538.38 Da
• Isoelectric Point: 8.2691

>T271696 WP_223200913.1 NZ_CP117611:c98263-98141 [Escherichia albertii]
IVCCTLLIFTLLTRNRLCEVRLKDGYREVTATMAYESGGK

Nucleotide

• Length: 123 bp

Antitoxin

Nucleotide

• Length: 217 bp

>AT271696 NZ_CP117611:c98564-98348 [Escherichia albertii]
TCACACGGATTGCCCGTGAACTGGCTGAACGACCAGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTATCCTGTCGTGCGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTCATTAACCCACGAGGCCTCTGCATGTCTAGTCCAC

Structures

Antitoxin