Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3801931..3802189 | Replicon | chromosome |
| Accession | NZ_CP117609 | ||
| Organism | Escherichia albertii strain BIA_26 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | PS038_RS18205 | Protein ID | WP_000809168.1 |
| Coordinates | 3802037..3802189 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3801931..3801988 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS038_RS18190 | 3797749..3798996 | - | 1248 | WP_025237694.1 | hypothetical protein | - |
| PS038_RS18195 | 3799150..3800643 | - | 1494 | WP_059218488.1 | sulfatase-like hydrolase/transferase | - |
| PS038_RS18200 | 3800664..3801425 | - | 762 | WP_001276206.1 | outer membrane protein OmpK | - |
| - | 3801931..3801988 | - | 58 | - | - | Antitoxin |
| PS038_RS18205 | 3802037..3802189 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| PS038_RS18210 | 3802297..3803427 | - | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
| PS038_RS18215 | 3803516..3805432 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| PS038_RS18220 | 3805807..3806211 | + | 405 | WP_000833521.1 | DUF2541 family protein | - |
| PS038_RS18225 | 3806238..3806951 | + | 714 | WP_001102345.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T271687 WP_000809168.1 NZ_CP117609:3802037-3802189 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT271687 NZ_CP117609:c3801988-3801931 [Escherichia albertii]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|