Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1096865..1097592 | Replicon | chromosome |
| Accession | NZ_CP117609 | ||
| Organism | Escherichia albertii strain BIA_26 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q3YYE6 |
| Locus tag | PS038_RS05245 | Protein ID | WP_000547563.1 |
| Coordinates | 1096865..1097176 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS038_RS05250 | Protein ID | WP_000126297.1 |
| Coordinates | 1097173..1097592 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS038_RS05215 (1092007) | 1092007..1093716 | + | 1710 | WP_025238503.1 | formate hydrogenlyase subunit HycE | - |
| PS038_RS05220 (1093726) | 1093726..1094268 | + | 543 | WP_000493797.1 | formate hydrogenlyase subunit HycF | - |
| PS038_RS05225 (1094268) | 1094268..1095035 | + | 768 | WP_000067396.1 | formate hydrogenlyase subunit HycG | - |
| PS038_RS05230 (1095032) | 1095032..1095442 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| PS038_RS05235 (1095435) | 1095435..1095905 | + | 471 | WP_059219259.1 | hydrogenase maturation peptidase HycI | - |
| PS038_RS05240 (1095948) | 1095948..1096703 | + | 756 | WP_059219258.1 | hypothetical protein | - |
| PS038_RS05245 (1096865) | 1096865..1097176 | + | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PS038_RS05250 (1097173) | 1097173..1097592 | + | 420 | WP_000126297.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PS038_RS05255 (1097684) | 1097684..1098112 | - | 429 | WP_000536065.1 | DUF4259 domain-containing protein | - |
| PS038_RS05260 (1098534) | 1098534..1099061 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
| PS038_RS05265 (1099214) | 1099214..1101466 | + | 2253 | WP_273818247.1 | carbamoyltransferase HypF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T271677 WP_000547563.1 NZ_CP117609:1096865-1097176 [Escherichia albertii]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15446.45 Da Isoelectric Point: 4.4596
>AT271677 WP_000126297.1 NZ_CP117609:1097173-1097592 [Escherichia albertii]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|