Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 248408..249120 | Replicon | chromosome |
| Accession | NZ_CP117609 | ||
| Organism | Escherichia albertii strain BIA_26 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7U8WCQ7 |
| Locus tag | PS038_RS01115 | Protein ID | WP_000162413.1 |
| Coordinates | 248818..249120 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS038_RS01110 | Protein ID | WP_000806446.1 |
| Coordinates | 248408..248746 (-) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS038_RS01085 (243509) | 243509..245491 | + | 1983 | WP_059215192.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
| PS038_RS01090 (245540) | 245540..246568 | + | 1029 | WP_059218981.1 | hematinate-forming heme oxygenase ChuS | - |
| PS038_RS01095 (246640) | 246640..247170 | - | 531 | WP_000480294.1 | LuxR C-terminal-related transcriptional regulator | - |
| PS038_RS01100 (247317) | 247317..247883 | - | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
| PS038_RS01105 (248172) | 248172..248351 | - | 180 | WP_059219034.1 | hypothetical protein | - |
| PS038_RS01110 (248408) | 248408..248746 | - | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
| PS038_RS01115 (248818) | 248818..249120 | - | 303 | WP_000162413.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS038_RS01120 (249284) | 249284..249763 | + | 480 | WP_000532312.1 | hypothetical protein | - |
| PS038_RS01125 (249853) | 249853..250026 | - | 174 | WP_044708027.1 | hypothetical protein | - |
| PS038_RS01130 (250054) | 250054..250137 | + | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
| PS038_RS01135 (250191) | 250191..251543 | - | 1353 | WP_059218982.1 | glutathione-disulfide reductase | - |
| PS038_RS01140 (251615) | 251615..252457 | - | 843 | WP_000954227.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11871.59 Da Isoelectric Point: 9.8664
>T271674 WP_000162413.1 NZ_CP117609:c249120-248818 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|