Detailed information of TA system TA271669

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 102576..102999
• Replicon: plasmid pEA29_1
• Accession: NZ_CP117607
• Organism: Escherichia albertii strain BIA_29

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PS031_RS23245
• Protein ID: WP_223200913.1
• Coordinates: 102576..102698 (-)
• Length: 41 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	102783..102999 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS031_RS23210 (97765)	97765..98166	-	402	WP_250188322.1	conjugal transfer relaxosome DNA-bindin protein TraY	-
PS031_RS23215 (98259)	98259..98948	-	690	WP_273773836.1	conjugal transfer transcriptional regulator TraJ	-
PS031_RS23220 (99135)	99135..99518	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PS031_RS23225 (99839)	99839..100441	+	603	WP_262930963.1	transglycosylase SLT domain-containing protein	-
PS031_RS23230 (100738)	100738..101559	-	822	WP_262931008.1	DUF932 domain-containing protein	-
PS031_RS23235 (101678)	101678..101964	-	287	Protein_106	hypothetical protein	-
PS031_RS23240 (101982)	101982..102275	+	294	Protein_107	hypothetical protein	-
PS031_RS23245 (102576)	102576..102698	-	123	WP_223200913.1	Hok/Gef family protein	Toxin
PS031_RS23250 (102643)	102643..102795	-	153	Protein_109	DUF5431 family protein	-
- (102783)	102783..102999	-	217	NuclAT_0	-	Antitoxin
- (102783)	102783..102999	-	217	NuclAT_0	-	Antitoxin
- (102783)	102783..102999	-	217	NuclAT_0	-	Antitoxin
- (102783)	102783..102999	-	217	NuclAT_0	-	Antitoxin
PS031_RS23255 (102968)	102968..103702	-	735	Protein_110	plasmid SOS inhibition protein A	-
PS031_RS23260 (103699)	103699..104133	-	435	WP_262930962.1	conjugation system SOS inhibitor PsiB	-
PS031_RS23265 (104188)	104188..105716	-	1529	Protein_112	ParB/RepB/Spo0J family partition protein	-
PS031_RS23270 (105780)	105780..106013	-	234	WP_262930961.1	DUF905 domain-containing protein	-
PS031_RS23275 (106071)	106071..106604	-	534	WP_099588255.1	single-stranded DNA-binding protein	-
PS031_RS23280 (106979)	106979..107359	-	381	WP_262930959.1	hypothetical protein	-
PS031_RS23285 (107405)	107405..107584	-	180	Protein_116	hypothetical protein	-
PS031_RS23290 (107570)	107570..107755	-	186	Protein_117	transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	vat / papD / papC / faeI / faeH / faeF / faeE / faeD / faeC	1..116006	116006

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (1-35)

Sequences

Toxin

Protein

• Length: 41 a.a.
• Molecular weight: 4538.38 Da
• Isoelectric Point: 8.2691

>T271669 WP_223200913.1 NZ_CP117607:c102698-102576 [Escherichia albertii]
IVCCTLLIFTLLTRNRLCEVRLKDGYREVTATMAYESGGK

Nucleotide

• Length: 123 bp

Antitoxin

Nucleotide

• Length: 217 bp

>AT271669 NZ_CP117607:c102999-102783 [Escherichia albertii]
TCACACAGATTACCTGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGTGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTATCCTGTCGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTCATTAACCCACGAGGCCTCTGCATGTCTAGTCCAC

Structures

Antitoxin