Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 65240..65494 | Replicon | plasmid pEA29_1 |
| Accession | NZ_CP117607 | ||
| Organism | Escherichia albertii strain BIA_29 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A148HBD8 |
| Locus tag | PS031_RS23025 | Protein ID | WP_001336447.1 |
| Coordinates | 65240..65389 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 65433..65494 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS031_RS22975 (60375) | 60375..60703 | - | 329 | Protein_54 | Tn3 family transposase | - |
| PS031_RS22980 (60704) | 60704..60915 | - | 212 | Protein_55 | 3'-5' exonuclease | - |
| PS031_RS22985 (60961) | 60961..61238 | - | 278 | Protein_56 | type II toxin-antitoxin system toxin YacB | - |
| PS031_RS22990 (61238) | 61238..61507 | - | 270 | WP_262930971.1 | type II toxin-antitoxin system antitoxin YacA | - |
| PS031_RS22995 (62420) | 62420..63277 | - | 858 | WP_122992027.1 | incFII family plasmid replication initiator RepA | - |
| PS031_RS23000 (63270) | 63270..63317 | - | 48 | WP_072248554.1 | hypothetical protein | - |
| PS031_RS23005 (63308) | 63308..63541 | + | 234 | WP_225856183.1 | replication protein RepA | - |
| PS031_RS23010 (63577) | 63577..63834 | - | 258 | WP_000083826.1 | replication regulatory protein RepA | - |
| PS031_RS23015 (64144) | 64144..64626 | - | 483 | WP_000405244.1 | GNAT family N-acetyltransferase | - |
| PS031_RS23020 (64617) | 64617..64919 | - | 303 | WP_001346256.1 | DUF1778 domain-containing protein | - |
| PS031_RS23025 (65240) | 65240..65389 | - | 150 | WP_001336447.1 | Hok/Gef family protein | Toxin |
| - (65433) | 65433..65494 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (65433) | 65433..65494 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (65433) | 65433..65494 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (65433) | 65433..65494 | + | 62 | NuclAT_1 | - | Antitoxin |
| PS031_RS23030 (65669) | 65669..66049 | - | 381 | Protein_65 | DUF2726 domain-containing protein | - |
| PS031_RS23035 (66240) | 66240..66452 | - | 213 | WP_273773806.1 | hypothetical protein | - |
| PS031_RS23040 (66588) | 66588..67148 | - | 561 | WP_074458664.1 | fertility inhibition protein FinO | - |
| PS031_RS23045 (67203) | 67203..67949 | - | 747 | WP_262930969.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | vat / papD / papC / faeI / faeH / faeF / faeE / faeD / faeC | 1..116006 | 116006 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T271667 WP_001336447.1 NZ_CP117607:c65389-65240 [Escherichia albertii]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT271667 NZ_CP117607:65433-65494 [Escherichia albertii]
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|