Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4462318..4462576 | Replicon | chromosome |
| Accession | NZ_CP117606 | ||
| Organism | Escherichia albertii strain BIA_29 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | - |
| Locus tag | PS031_RS21655 | Protein ID | WP_001519334.1 |
| Coordinates | 4462318..4462470 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 4462519..4462576 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS031_RS21635 | 4457560..4458273 | - | 714 | WP_204628791.1 | acidic protein MsyB | - |
| PS031_RS21640 | 4458300..4458704 | - | 405 | WP_273771206.1 | DUF2541 family protein | - |
| PS031_RS21645 | 4459079..4460995 | + | 1917 | WP_000516137.1 | molecular chaperone DnaK | - |
| PS031_RS21650 | 4461084..4462214 | + | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
| PS031_RS21655 | 4462318..4462470 | - | 153 | WP_001519334.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 4462519..4462576 | + | 58 | - | - | Antitoxin |
| PS031_RS21660 | 4463092..4463853 | + | 762 | WP_208625529.1 | outer membrane protein OmpK | - |
| PS031_RS21665 | 4463874..4465367 | + | 1494 | WP_204628790.1 | sulfatase-like hydrolase/transferase | - |
| PS031_RS21670 | 4465521..4466768 | + | 1248 | WP_262931223.1 | cytoplasmic protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5515.59 Da Isoelectric Point: 7.1312
>T271665 WP_001519334.1 NZ_CP117606:c4462470-4462318 [Escherichia albertii]
MKQHKAMIIALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIIALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT271665 NZ_CP117606:4462519-4462576 [Escherichia albertii]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|