Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 4387418..4387831 | Replicon | chromosome |
Accession | NZ_CP117606 | ||
Organism | Escherichia albertii strain BIA_29 |
Toxin (Protein)
Gene name | symE | Uniprot ID | - |
Locus tag | PS031_RS21290 | Protein ID | WP_059250864.1 |
Coordinates | 4387418..4387759 (-) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4387754..4387831 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS031_RS21270 (4383793) | 4383793..4384725 | + | 933 | WP_204628804.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
PS031_RS21275 (4384877) | 4384877..4385050 | - | 174 | Protein_4144 | GntR family transcriptional regulator | - |
PS031_RS21280 (4385275) | 4385275..4386151 | + | 877 | Protein_4145 | DUF262 domain-containing protein | - |
PS031_RS21285 (4386205) | 4386205..4387371 | + | 1167 | WP_273771112.1 | DUF1524 domain-containing protein | - |
PS031_RS21290 (4387418) | 4387418..4387759 | - | 342 | WP_059250864.1 | endoribonuclease SymE | Toxin |
- (4387754) | 4387754..4387831 | + | 78 | NuclAT_8 | - | Antitoxin |
- (4387754) | 4387754..4387831 | + | 78 | NuclAT_8 | - | Antitoxin |
- (4387754) | 4387754..4387831 | + | 78 | NuclAT_8 | - | Antitoxin |
- (4387754) | 4387754..4387831 | + | 78 | NuclAT_8 | - | Antitoxin |
- (4387754) | 4387754..4387831 | + | 78 | NuclAT_9 | - | Antitoxin |
- (4387754) | 4387754..4387831 | + | 78 | NuclAT_9 | - | Antitoxin |
- (4387754) | 4387754..4387831 | + | 78 | NuclAT_9 | - | Antitoxin |
- (4387754) | 4387754..4387831 | + | 78 | NuclAT_9 | - | Antitoxin |
PS031_RS21295 (4387988) | 4387988..4389373 | - | 1386 | WP_059257978.1 | restriction endonuclease subunit S | - |
PS031_RS21300 (4389370) | 4389370..4390959 | - | 1590 | WP_074463834.1 | type I restriction-modification system methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12326.12 Da Isoelectric Point: 7.8219
>T271663 WP_059250864.1 NZ_CP117606:c4387759-4387418 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTTQPPAAEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTTQPPAAEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 78 bp
>AT271663 NZ_CP117606:4387754-4387831 [Escherichia albertii]
AGTCATAACTGCTATTCCTTGGAAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCTTGGAAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|