Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HTH(antitoxin)
Location 3855958..3856560 Replicon chromosome
Accession NZ_CP117606
Organism Escherichia albertii strain BIA_29

Toxin (Protein)


Gene name higB Uniprot ID S1P416
Locus tag PS031_RS18830 Protein ID WP_000897302.1
Coordinates 3855958..3856269 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PS031_RS18835 Protein ID WP_000356397.1
Coordinates 3856270..3856560 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS031_RS18800 (3850988) 3850988..3851773 + 786 WP_000059671.1 DeoR/GlpR family DNA-binding transcription regulator -
PS031_RS18805 (3851872) 3851872..3852471 + 600 WP_204628899.1 glucose-1-phosphatase -
PS031_RS18810 (3852465) 3852465..3853337 + 873 WP_000916663.1 virulence factor BrkB family protein -
PS031_RS18815 (3853334) 3853334..3853771 + 438 WP_000560977.1 D-aminoacyl-tRNA deacylase -
PS031_RS18820 (3853816) 3853816..3854757 + 942 WP_001297068.1 fatty acid biosynthesis protein FabY -
PS031_RS18825 (3854821) 3854821..3855729 - 909 WP_059239594.1 alpha/beta hydrolase -
PS031_RS18830 (3855958) 3855958..3856269 + 312 WP_000897302.1 hypothetical protein Toxin
PS031_RS18835 (3856270) 3856270..3856560 + 291 WP_000356397.1 NadS family protein Antitoxin
PS031_RS18840 (3856645) 3856645..3856857 + 213 WP_000197774.1 hypothetical protein -
PS031_RS18845 (3856919) 3856919..3857197 + 279 WP_032278934.1 hypothetical protein -
PS031_RS18850 (3857596) 3857596..3857814 + 219 WP_001314326.1 CopG family transcriptional regulator -
PS031_RS18855 (3858042) 3858042..3858284 + 243 WP_001275524.1 CopG family transcriptional regulator -
PS031_RS18860 (3858284) 3858284..3858658 + 375 WP_001129491.1 PIN domain-containing protein -
PS031_RS18865 (3858695) 3858695..3859624 - 930 WP_000027704.1 formate dehydrogenase accessory protein FdhE -
PS031_RS18870 (3859621) 3859621..3860256 - 636 WP_000829019.1 formate dehydrogenase cytochrome b556 subunit -
PS031_RS18875 (3860253) 3860253..3861155 - 903 WP_000331386.1 formate dehydrogenase O subunit beta -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(36-85)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12203.19 Da        Isoelectric Point: 9.7791

>T271660 WP_000897302.1 NZ_CP117606:3855958-3856269 [Escherichia albertii]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW

Download         Length: 312 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10846.43 Da        Isoelectric Point: 10.8907

>AT271660 WP_000356397.1 NZ_CP117606:3856270-3856560 [Escherichia albertii]
MDKALFERLTHSMAQMNEIIEGTRQPSRTFEVDAMKIKEIRRASGLSQSKFADLISVSVDTLRNWEQGRRSPTGPAKALL
RAIANDPQHVLQALNR

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1P416

Antitoxin

Source ID Structure

References