Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3499978..3500235 | Replicon | chromosome |
| Accession | NZ_CP117606 | ||
| Organism | Escherichia albertii strain BIA_29 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | V0YDF1 |
| Locus tag | PS031_RS17120 | Protein ID | WP_001135738.1 |
| Coordinates | 3499978..3500130 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 3500187..3500235 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS031_RS17090 | 3496083..3496742 | + | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
| PS031_RS17095 | 3496846..3497820 | + | 975 | WP_000804993.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| PS031_RS17100 | 3497873..3498583 | - | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
| PS031_RS17105 | 3499006..3499296 | + | 291 | WP_000455794.1 | HTH-type transcriptional regulator | - |
| PS031_RS17110 | 3499579..3499791 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| PS031_RS17115 | 3499930..3500001 | + | 72 | WP_212743705.1 | hypothetical protein | - |
| PS031_RS17120 | 3499978..3500130 | - | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| - | 3500187..3500235 | + | 49 | - | - | Antitoxin |
| PS031_RS17125 | 3500452..3502521 | - | 2070 | WP_001291807.1 | glycine--tRNA ligase subunit beta | - |
| PS031_RS17130 | 3502531..3503442 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| PS031_RS17135 | 3503538..3503837 | - | 300 | WP_204628985.1 | YsaB family lipoprotein | - |
| PS031_RS17140 | 3504010..3505005 | + | 996 | WP_273770034.1 | acyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T271659 WP_001135738.1 NZ_CP117606:c3500130-3499978 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
Antitoxin
Download Length: 49 bp
>AT271659 NZ_CP117606:3500187-3500235 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|