Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3418306..3419018 | Replicon | chromosome |
| Accession | NZ_CP117606 | ||
| Organism | Escherichia albertii strain BIA_29 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7U8WCQ7 |
| Locus tag | PS031_RS16755 | Protein ID | WP_000162413.1 |
| Coordinates | 3418306..3418608 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS031_RS16760 | Protein ID | WP_000806446.1 |
| Coordinates | 3418680..3419018 (+) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS031_RS16730 (3414969) | 3414969..3415811 | + | 843 | WP_010326142.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
| PS031_RS16735 (3415883) | 3415883..3417235 | + | 1353 | WP_149541542.1 | glutathione-disulfide reductase | - |
| PS031_RS16740 (3417289) | 3417289..3417372 | - | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
| PS031_RS16745 (3417400) | 3417400..3417573 | + | 174 | WP_187765834.1 | hypothetical protein | - |
| PS031_RS16750 (3417663) | 3417663..3418142 | - | 480 | WP_204628992.1 | hypothetical protein | - |
| PS031_RS16755 (3418306) | 3418306..3418608 | + | 303 | WP_000162413.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS031_RS16760 (3418680) | 3418680..3419018 | + | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
| PS031_RS16765 (3419109) | 3419109..3419258 | + | 150 | WP_233991781.1 | hypothetical protein | - |
| PS031_RS16770 (3419605) | 3419605..3420171 | + | 567 | WP_059216822.1 | outer membrane lipoprotein Slp | - |
| PS031_RS16775 (3420318) | 3420318..3420848 | + | 531 | WP_000480294.1 | LuxR C-terminal-related transcriptional regulator | - |
| PS031_RS16780 (3420920) | 3420920..3421948 | - | 1029 | WP_001110408.1 | hematinate-forming heme oxygenase ChuS | - |
| PS031_RS16785 (3421997) | 3421997..3423979 | - | 1983 | WP_103054026.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11871.59 Da Isoelectric Point: 9.8664
>T271658 WP_000162413.1 NZ_CP117606:3418306-3418608 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|