Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3073077..3073876 | Replicon | chromosome |
| Accession | NZ_CP117606 | ||
| Organism | Escherichia albertii strain BIA_29 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | PS031_RS14955 | Protein ID | WP_000347251.1 |
| Coordinates | 3073412..3073876 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | PS031_RS14950 | Protein ID | WP_001296435.1 |
| Coordinates | 3073077..3073412 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS031_RS14935 (3068866) | 3068866..3069636 | - | 771 | WP_025238278.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| PS031_RS14940 (3069652) | 3069652..3070986 | - | 1335 | WP_025238277.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PS031_RS14945 (3071357) | 3071357..3072928 | + | 1572 | WP_273769546.1 | galactarate dehydratase | - |
| PS031_RS14950 (3073077) | 3073077..3073412 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PS031_RS14955 (3073412) | 3073412..3073876 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PS031_RS14960 (3073931) | 3073931..3074740 | - | 810 | WP_103053960.1 | aga operon transcriptional regulator AgaR | - |
| PS031_RS14965 (3074989) | 3074989..3076269 | + | 1281 | WP_059216469.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PS031_RS14970 (3076292) | 3076292..3076765 | + | 474 | WP_059218168.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PS031_RS14975 (3076776) | 3076776..3077555 | + | 780 | WP_000406226.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PS031_RS14980 (3077545) | 3077545..3078423 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PS031_RS14985 (3078441) | 3078441..3078875 | + | 435 | WP_000948821.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T271657 WP_000347251.1 NZ_CP117606:3073412-3073876 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PPV5 |