Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3032309..3033036 | Replicon | chromosome |
| Accession | NZ_CP117606 | ||
| Organism | Escherichia albertii strain BIA_29 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | PS031_RS14755 | Protein ID | WP_000550189.1 |
| Coordinates | 3032722..3033036 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS031_RS14750 | Protein ID | WP_000560272.1 |
| Coordinates | 3032309..3032725 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS031_RS14740 (3027624) | 3027624..3029975 | + | 2352 | WP_273769472.1 | alpha-glucosidase | - |
| PS031_RS14745 (3030201) | 3030201..3032219 | + | 2019 | WP_204629079.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| PS031_RS14750 (3032309) | 3032309..3032725 | - | 417 | WP_000560272.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| PS031_RS14755 (3032722) | 3032722..3033036 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| PS031_RS14760 (3033319) | 3033319..3034455 | - | 1137 | WP_059241776.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| PS031_RS14765 (3034540) | 3034540..3035043 | + | 504 | WP_204629078.1 | M48 family metallopeptidase | - |
| PS031_RS14770 (3035120) | 3035120..3035812 | + | 693 | WP_204629077.1 | vancomycin high temperature exclusion protein | - |
| PS031_RS14775 (3035891) | 3035891..3036877 | + | 987 | WP_000617693.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T271656 WP_000550189.1 NZ_CP117606:c3033036-3032722 [Escherichia albertii]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14993.40 Da Isoelectric Point: 4.3697
>AT271656 WP_000560272.1 NZ_CP117606:c3032725-3032309 [Escherichia albertii]
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMPGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMPGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|